Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40820-AT3G56480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):myosin heavy chain-related

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.26707353559584
Log2 mRNA fold difference:1.2715931403478
Log2 TE fold difference:-1.019751042593
Sequences
Protein sequence

MTKVCPKTEEKRVVSEAVVEPISADVSFASNHFPTYKLGPDDQIVDEPDEDDKVPSVKDV
VGKETGDLSDQHKKLSVRDLACKFDKNLAAASKLVDEAKLNDVTSLEGHVMLKKLRDALE
TMRGRMDGRNREAVEKAISMVEALAVKLTQNEGELIHDKFEVKKLASFLKKASDDAKKLV
NQEKSFACAEIESARALVMKLGGAFEEQELCSKASRDQGPNVEKLVEEVQEARRIRRLHK
PTMVIGMQHELRDLKSQIQEKSAYSVKLQREIAIIKKAEGSKSCPYVLDGAQSLGSCLRI
RASSDSGIDISKCSIHWYRAASESSRREAISGANRSVYAPEPFDVGRVIQADIVSNGQKF
TVTTDGPINTAAGLQSRVESLLRKSNSEFTVVISQMNGQDHASRSHVFTVGKARIKLSRG
WITKAREIYSTSMQLCGVRGNANVPAKALFWQLRKGLTFLLTFESEQERNAAIVLARTYA
YDCNVTLVGPDD

MTKVCPEIEGTLSLSVVPVSVDVSFASDHFPTYKLGPDNQIVEEPKEDEKGPSVKETVEK
ESELLSDQHKRLSVRDLASKFDKNLAAAVSLANEAKLREVASLEGHVMLKKLRDALEYMR
GRTDGQNKQDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVNQE
KSFSCAEIETARAVVLRLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHPTK
VMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGKQSLGSCLRIRVN
AQDNAPDLSNCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKFTV
TTDDPVDPDSGLPSRVESLMRKSNSEFSVVISQMNGQDYASRSHVFTVGKTRIKLSRGWI
TKARELYSTSMQLCGVRGNIKAPTKAVFWQPRKSLTFILTFESEHERNAAIALARKYAFD
CSVTLLGPDD

www.000webhost.com

Other information
Ka divergence:-0.00288517KaKs divergence:-0.0805327
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1479Length 2 (bp):1473Length divergence:-0.002
MFE 1 (kcal):-436.56MFE 2 (kcal):-449.84MFE divergence0.015