Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40830-AT3G56580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING-H2 finger C1A
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.2145937378325
Log2 mRNA fold difference:-0.16607026966548
Log2 TE fold difference:0.3815771713079
Sequences
Protein sequence

MSSSRNTHWCHRCQRAVRLHGQEPVCFYCGGGFVEELDMAQASPFDMFRSHRGVVERDQT
FDLMDAFSVFMRNRLAERSHDREIRGRTISSGPENFPGLAPLLIFGGQVPYRLTGDNAVE
ALFNGGSPGIGITRGNTGDYFFGPGLEELFEQLSAGTTRRGPPPAPRSAIDALPTIKIAQ
RHLRSSDSNCPVCKDEFELGSEAKQMPCNHIYHSDCIVPWLVQHNSCPVCRQELPSASGP
SSSQNRTTPTRNYRSSSSSSSSNSRENGNERRNPFSSFWPFRSSGSSSSSTQNRGGTRNS
DTSDENHNYHQQQHQQSYMGYSGWPFDY

MSSIRNTHWCHRCQRAVWLRARDAVCSYCGGGFVEEIDIGPSRAHRDVERDPTFDLMEAF
SAFMRSRLAERSYDREISGRLGSAGSESFSNLAPLLIFGGQAPFRLAGGDNSSVEAFVNG
AAPGIGIARGTNAGDYFFGPGLEELIEQLSSGTHHRGPPPAPKSSIDALPTIKITQKHLK
SSDSHCPVCKDEFELKSEAKQMPCHHIYHSDCIVPWLVQHNSCPVCRKELPSRGSSSSTQ
SSQNRSTNGRENSRRRNIFSNLWPFRSSSSSSTQNRRDTNNTATAEEGHYHHHQQQQQQH
QHQHQQQQSHMGYSGWPFDY

www.000webhost.com

Other information
Ka divergence:0.154813KaKs divergence:0.270696
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):987Length 2 (bp):963Length divergence:-0.012
MFE 1 (kcal):-321.64MFE 2 (kcal):-291.7MFE divergence-0.049