Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40960-AT3G56680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Single-stranded nucleic acid binding R3H protein
Function (paralog2):Single-stranded nucleic acid binding R3H protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.6083630441968
Log2 mRNA fold difference:2.1269882812561
Log2 TE fold difference:0.46429264239202
Sequences
Protein sequence

MDTALTSESGCAVIADKGFNVDPFLVEALQNPRHRLTILRMELDVQRFLQSPDQQQFEFQ
HFPTSYLRFAAHRVANHYGLITSVRDGGADGNESRIVVTKSSDSRFPAARLSEIPVKQSE
TGKFEHMKVVIKPRPTKGSGMEGDELKGGLLKSVEERKEDYDRARARIFNGLVNIDCNDS
SSETNPWRVNCSSSRDENQVLKNGNIEADKNNISRKSNPASRIAILRDREKDRYDPDYDR
SNYRYISNLPVDQNLCVAHFNIQTMGTPIYDMGFRGYSPTAPPSLNLGQHSVMSPCVTTG
LNQPSRDAAMYMQWPNAAAVMYTHSYDHFRNSPFQAQFYPQPLSFDYMQNR

MDVVLPETAVVTGGSVIGDYGFNVDPFLVEALHNSRHRLTILRMELDVQRLLQNPEQQQF
EFQHFPTSYLRLAAHRVANHYGLATAVQESGADGNENRILVTKTTESKFPAVRLSEIPVA
KQSENGKFESRKVSIKTRPSKGSGYGAGDLEKNRGPLRSVEERKEEYDKARERIFSGLTG
LSCDDSSSETQVYERNASLSRDDKQVSKNAYVEVKKNLSIRESGPTSRVAIFRDREKDRF
DPDYDRRHQRYIRSLPVNQNFNLPPFNIQQIPTPYYEMGFTGYNQIPSPPAPLGFGPHPS
SIMSPYGTTMDAMYMHWPNAAMMYAHPYEQFRNGSLQAQFVQQPLSFDYMQNR

www.000webhost.com

Other information
Ka divergence:-0.166088KaKs divergence:-0.275788
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1056Length 2 (bp):1062Length divergence:0.003
MFE 1 (kcal):-312.47MFE 2 (kcal):-328.1MFE divergence0.024