Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41010-AT3G56880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calmodulin (CAM)-binding protein of 25 kDa
Function (paralog2):VQ motif-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.1252076553362
Log2 mRNA fold difference:1.5107462808127
Log2 TE fold difference:-0.45967209283477
Sequences
Protein sequence

MVTSEGLASVDSWLYRQGFNVDSWLLSDTFSHDNDLLARALHTTVTAPHTLTPSSAFFDS
SAVSHPSSTNTLSSTVSGASDPEIIGGGAKRKRNCLLTDGKAAKRRARASKKSQTTFITA
DPSNFRQMVQQVTGAKYIDDSSSFGIFDPIVKPEPLRFVNKLPCGPSDRSTAVPMLDTSA
FLSNHHQENLAVGNAFSGNSSSVGLPSGKPSATADPGGSAVEFDNYPTFPTLESWKVM

MASSEGLASVDPWSFRQNFNIDSWLLSDSFSHDSDILAKALHRSISTSTESSPLSPSSFF
DSSTAAVDFSPPQTLSNVSFGSDPEIPAASALGLGKRKRGPGVSGGKQTKRRSRVSNKKS
QTTFITADAANFRQMVQQVTGAKFLGSSNSIFAPIVKPEPHRLASRLPPSCGNLDRSSAV
PTLDTSSFLSNHHQENIITDLGAPTGSFHHQSSAGTTTANVGGGSSAVELDSYPSFPTLE
SWKVM

www.000webhost.com

Other information
Ka divergence:-0.27665KaKs divergence:0.694996
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):717Length 2 (bp):738Length divergence:0.014
MFE 1 (kcal):-223.44MFE 2 (kcal):-205.16MFE divergence-0.043