Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41060-AT3G56860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):UBP1-associated protein 2A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1898028475359
Log2 mRNA fold difference:1.7236678145542
Log2 TE fold difference:0.42383325903676
Sequences
Protein sequence

MTKKRKLESESNETSEPTEKQQQQCEKEDPEIRNVDNQRDDDEQVVEQDTLKEMHEEEAK
GEDNIEAETSSGSGNQGNEDDDEEEPIEDLLEPFSKDQLLILLKEAAERHRDVANRIRIV
ADEDLVHRKIFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRS
GARNALKQPQKKIGTRMTACQLASIGPVQGNPVVAPAQHFNPENVQRKIYVSNVSADIDP
QKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCH
KANDGPKQVKQHQHNHNSHNQNSRYQRNDNNGYGAPGGHGHFIAGNNQAVQAFNPAIGQA
LTALLASQGAGLGLNQAFGQALLGTLGTASPGAVGGMPSGYGTQANISPGVYPGYGAQAG
YQGGYQTQQPGQGGAGRGQHGAGYGGPYMGR

MTKKRKLEGEESNEAEEPSQKLKQTPEEEQQLVIKNQDNQGDVEEVEYEEVEEEQEEEVE
DDDDEDDGDENEDQTDGNRIEAAATSGSGNQEDDDDEPIQDLLEPFSKEQVLSLLKEAAE
KHVDVANRIREVADEDPVHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKS
KGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGPVFGGAPIAAAAVSAPAQHSNS
EHTQKKIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAK
RALEEPHKTFEGHILHCQKAIDGPKPGKQQQHHHNPHAYNNPRYQRNDNNGYGPPGGHGH
LMAGNPAGMGGPTAQVINPAIGQALTALLASQGAGLAFNPAIGQALLGSLGTAAGVNPGN
GVGMPTGYGTQAMAPGTMPGYGTQPGLQGGYQTPQPGQGGTSRGQHGVGPYGTPYMGH

www.000webhost.com

Other information
Ka divergence:-0.106705KaKs divergence:-0.31416
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1356Length 2 (bp):1437Length divergence:0.029
MFE 1 (kcal):-446.4MFE 2 (kcal):-483.44MFE divergence0.04