Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41070-AT3G56850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Basic-leucine zipper (bZIP) transcription factor family protein
Function (paralog2):ABA-responsive element binding protein 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.6268760569311
Log2 mRNA fold difference:1.9149703552619
Log2 TE fold difference:0.56223936171504
Sequences
Protein sequence

MGSIRGNIEEPISQSLTRQNSLYSLKLHEVQTHLGSSGKPLGSMNLDELLKTVLPPAEEG
LVRQGSLTLPRDLSKKTVDEVWRDIQQDKNGNGTSTTTTHKQPTLGEITLEDLLLRAGVV
TETVVPQENVVNIASNGQWVEYHHQPQQQQGFMTYPVCEMQDMVMMGGLSDTPQAPGRKR
VAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRRLKEVEK
ILPSEPPPDPKWKLRRTNSASL

MDSQRGIVEQAKSQSLNRQSSLYSLTLDEVQNHLGSSGKALGSMNLDELLKSVCSVEANQ
PSSMAVNGGAAAQEGLSRQGSLTLPRDLSKKTVDEVWKDIQQNKNGGSAHERRDKQPTLG
EMTLEDLLLKAGVVTETIPGSNHDGPVGGGSAGSGAGLGQNITQVGPWIQYHQLPSMPQP
QAFMPYPVSDMQAMVSQSSLMGGLSDTQTPGRKRVASGEVVEKTVERRQKRMIKNRESAA
RSRARKQAYTHELEIKVSRLEEENERLRKQKEVEKILPSVPPPDPKRQLRRTSSAPF

Other information
Ka divergence:-0.316278KaKs divergence:-0.0232254
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):789Length 2 (bp):894Length divergence:0.062
MFE 1 (kcal):-238.23MFE 2 (kcal):-292.56MFE divergence0.102