Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41140-AT3G56760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CDPK-related kinase 1
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.7369902162141
Log2 mRNA fold difference:-1.0306896574806
Log2 TE fold difference:0.28145918597278
Sequences
Protein sequence

MGICHGKPVEQQSKSLPVSGETNEAPTNSQPPAKSSGFPFYSPSPVPSLFKSSPSVSSSV
SSTPLRIFKRPFPPPSPAKHIRAFLARRYGSVKPNEVSIPEGKECEIGLDKSFGFSKQFA
SHYEIDGEVGRGHFGYTCSAKGKKGSLKGQEVAVKVIPKSKMTTAIAIEDVSREVKMLRA
LTGHKNLVQFYDAFEDDENVYIVMELCKGGELLDKILQRGGKYSEDDAKKVMVQILSVVA
YCHLQGVVHRDLKPENFLFSTKDETSPLKAIDFGLSDYVKPDERLNDIVGSAYYVAPEVL
HRTYGTEADMWSIGVIAYILLCGSRPFWARTESGIFRAVLKAEPNFEEAPWPSLSPEAVD
FVKRLLNKDYRKRLTAAQALCHPWLVGSHELKIPSDMIIYKLVKVYIMSTSLRKSALAAL
AKTLTVPQLAYLREQFTLLGPSKNGYISMQNYKTAILKSSTDAMKDSRVFDFVHMISCLQ
YKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFEKDGNRPIMIEELASELGLGPSVP
VHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQKA

MGLCHGKPIEQQSKNLPISNEIEETPKNSSQKAKSSGFPFYSPSPLPSLFKTSPAVSSSS
VSSTPLRIFKRPFPPPSPAKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQF
ASHYEIDGEVGRGHFGYTCSAKGKKGSLKGQDVAVKVIPKSKMTTAIAIEDVRREVKILR
ALTGHKNLVQFYDAFEDDENVYIVMELCQGGELLDKILQRGGKYSEVDAKKVMIQILSVV
AYCHLQGVVHRDLKPENFLFTTKDESSPLKAIDFGLSDYVRPDERLNDIVGSAYYVAPEV
LHRTYGTEADMWSIGVIAYILLCGSRPFWARSESGIFRAVLKAEPNFEEAPWPSLSPDAV
DFVKRLLNKDYRKRLTAAQALCHPWLVGSHELKIPSDMIIYKLVKVYIMSSSLRKSALAA
LAKTLTVPQLTYLQEQFNLLGPSKNGYISMQNYKTAILKSSTEATKDSRVLDFVHMISCL
QYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELYEKDGNRVIMIEELATELGLGPSV
PVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQKA

www.000webhost.com

Other information
Ka divergence:-0.024693KaKs divergence:0.106212
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1731Length 2 (bp):1734Length divergence:0.001
MFE 1 (kcal):-512.2MFE 2 (kcal):-526.49MFE divergence0.014