Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41150-AT3G56750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.4187803145883
Log2 mRNA fold difference:0.10533609705015
Log2 TE fold difference:1.3713231031856
Sequences
Protein sequence

MATMSKPHKLKATPGSQRLVLLCIVAVAFLLLFTSVISTGGLALPYRTTLIGYFVRSTRN
KTQHSLSDKYLYWGNRIDCPGKNCETCAGLGHQESSLRCALEEAMFLNRTFVMPSRMCIN
PIHNKKGILNRSNNETREESWEVSSCAMESLYDIDLISEKIPVILDDSETWHIMLSTSMK
LKERGSAHVYGANRHELNDSSDFTNLLLINRTASPLAWFVECKDRGNRSDVMLPYSFLQT
MAASRLRDAAEKIKAKLGDYDAIHVRRGDKLKTRKDRFRVERSQFPHLDRDTRPEFIIGR
IQKQIPPGRTLFIGSNERTPDFFSPLAIRYKVAYSSNFSEILDPIIENNYQLFMVERLIM
MGAKTFFKTFREYETDLTLTDDPKKNKNWEIPVYTMDEGKEAAS

MATMSKAQRTKPTSGSQRLVLFCIVVFSFLLLFSSVISTGKLGLPYQQTLIDYFVWSPRG
KRQHSLSEKYLYWGNRIDCPGKNCETCAGLGHQESSLRCALEEAMFLNRTFVMPSGMCIN
PIHNKKGILNRSDNKTTEEGWLGSSCAMDSLYDIDLISEKIPVILDDSKTWHIVLSTSMK
LGERGIAHVSGVTRHRLKESHYSNLLIINRTASPLAWFVECKDRSNRSAVMLPYSFLPNM
AAAKLRNAAEKIKAQLGDYDAIHVRRGDKLKTRKDRFGVERIQFPHLDRDTRPEFILRRI
EKRIPRGRTLFIGSNERKPGFFSPLAVRYKLAYSSNFSEILDPIIENNYQLFMMERLVMM
GAKTYFKTFKEYETDLTLTDDPKKNKNWEIPVYTMDERREEAS

www.000webhost.com

Other information
Ka divergence:-0.114784KaKs divergence:-0.285043
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1215Length 2 (bp):1212Length divergence:-0.001
MFE 1 (kcal):-336.74MFE 2 (kcal):-359.31MFE divergence0.032