Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41160-AT3G56740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquitin-associated (UBA) protein
Function (paralog2):Ubiquitin-associated (UBA) protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.0412798135283
Log2 mRNA fold difference:-0.31914391899277
Log2 TE fold difference:-0.70912608644937
Sequences
Protein sequence

MNGGPSGFNNAPVTKAFVIATALFTVFFGIRGGSSKLGLSYQDIFEKFRIWKLIISAFAF
SSTTQLLSGLYLLYFFRVFERQIGSNKYSVFIFFSGFVSLILETILLSLTKDPTANLLTS
GPYALVFASFVPFFLDIPVTKRFGVLGVHFSDKSFIYLAGVQLLLSSWKRSIFTGICGII
AGSLYRLNIFGIRKAKFPEFMASLFSRFSLPSLSSHSQPPRRTSPNLGRQAVRAYRAPMP
STTEPSEEAIATLVSMGFDQNAARQALVHARNDVNAATNILLEAHSH

MNGGPSGFHNAPVTKAFVITSALFTVFFGIQGRSSKLGLSYQDIFEKFRIWKLIMSTFAF
SSTPELMFGLYLLYYFRVFERQIGSNKYSVFILFSGTVSLLLEVILLSLLKDTTANLLTS
GPYGLIFASFIPFYLDIPVSTRFRVFGVNFSDKSFIYLAGVQLLLSSWKRSIFPGICGII
AGSLYRLNILGIRKAKFPEFVASFFSRLSFPSFGNSPPPAPSRNIVGTISPNTGRRAERS
QPAPLPSSVEPSEEAITTLVSMGFDRNAARQALVHARNDVNAATNILLEAQSH

www.000webhost.com

Other information
Ka divergence:-0.292129KaKs divergence:-0.366237
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):864Length 2 (bp):882Length divergence:0.01
MFE 1 (kcal):-237.52MFE 2 (kcal):-241.53MFE divergence0.008