Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41180-AT3G56710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):VQ motif-containing protein
Function (paralog2):sigma factor binding protein 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.62228239368174
Log2 mRNA fold difference:-1.4706891722127
Log2 TE fold difference:0.89448964730542
Sequences
Protein sequence

MDQSSSTLLINQRKSSSSPTRIPPKQKRKSTTTHKPIKVRYISNPMRVETCPSKFRELVQ
ELTGQDAADLPPSPTTFTAVDLHRPCESEMNLEPLDGEVRGEYYSPLDEEVFNAPQMSAG
LSGFFSSGFYNVNALGSIGSL

MESSSSTFLTTTSLDKKKPSPVSRKSPKQKKKTTSTNKPIKVRYISNPMRVQTCASKFRE
LVQELTGQDAVDLQPEPIYSPSSDDHNLSPPAENLAPRVLHQEPFGERDSDCYEPLNAED
MFLPDQMSAGFSGFFSNGFYNVNDFGSIDSM

Other information
Ka divergence:0.0637606KaKs divergence:0.435624
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):426Length 2 (bp):456Length divergence:0.034
MFE 1 (kcal):-114.56MFE 2 (kcal):-117.91MFE divergence0.014