Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41210-AT3G56960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphatidylinositol- 4-phosphate 5-kinase 5
Function (paralog2):phosphatidyl inositol monophosphate 5 kinase 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.13174172035523
Log2 mRNA fold difference:0.40443584434293
Log2 TE fold difference:-0.26246448419336
Sequences
Protein sequence

MSKDQSYVLKAWEVTVRKTQQAKKRANSVFGTVSVAPHTDNDTTTDDNDDETTTNRSSLE
EFYHAERVLPNGDYYTGQWYDSFPHGHGKYLWTDGCMYIGDWYNGKTMGNGKFGWPSGAT
YEGEFKSGYMDGIGTYTGPSGDAYKGQWVMNLKHGHGVKSFANGDAYDGEWRRGLQEGQG
KYQWSDGSYYIGEWKNGTICGKGSFVWTNGNRYDGFWDEGFPRGNGTFKWDNGSFYVGHW
SKDPEEMNGTYYPSGNEGNLEWDPKDLFNNLSEYTICSGERVPTLPSQKKLSVWNSSKRI
EKPRRTSVDGRVSVGVDRAFEKMNMWGNEIGEGGADMRKELDAELMRLDAEGLQSLKSSP
VPMKLPKAGRKQGETISKGHRNYELMLNLQLGIRHSVGRQAPAASLDLKPSAFDPKDKIW
RRFPREGTKYTPPHQSTEFKWKDYCPLVFRSLRKLFKVDPADYMLSICGNDALRELSSPG
KSGSFFYLTNDDRYMIKTMKKSETKVLLGMLAAYYNHVRAFENSLVIRFFGLHCVKLNGP
TQKKVRFVIMGNLFCSKYSVHRRFDLKGSSLGRTTDKPESEIDSNTILKDLDLNFIFRLQ
KAWYQEFIRQIDKDCEFLEQERIMDYSLLVGIHFREASVAGELIPSGARTPIGESEEESG
PRLSRAEVDELLSDPSRWASIRLGTNMPARAERTMRKNDSELQLVGEPTGEFYEVVMIFG
IIDILQDYDISKKLEHAYKSIQYDPSSISAVDPRQYSRRFRDFIFKVFTDDN

MSKEQSCVLKAWEVTVRKTQQAKKRANSIFGTVSVAPQTDDDATTTTEENDDETSTNRSS
IGELYHAERILPNGDYYTGQWYDSFPHGHGKYLWTDGCMYIGDWYNGKTMGRGKFGWPSG
ATYEGEFKSGYMDGVGLYTGPSGDTYKGQWVMNLKHGHGIKRFANGDVYDGEWRRGLQEA
QGKYQWRDGSYYMGEWKNATICGKGTFIWTDGNRYDGFWDDGFPRGNGTFKWADGSFYVG
HWSNDPEEMNGTYYPSGDDGSPEWDPKDVFTNLSEYKICSGERVPVLPSQKKLSVWNSSK
RVEKPRRMSVDGRVSVGVDRAFEKMNMWGTESGEGAADIDSTTRRDLDAEMMRLEAEGFI
QSLRPSPAPMRLPRAGRKQGETISKGHRNYELMLNLQLGIRHAVGKQAPVVSLDLKHSAF
DPKEKVWTRFPPEGTKYTPPHQSSEFKWKDYCPLVFRSLRKLFKVDPADYMLSICGNDAL
RELSSPGKSGSFFYLTNDDRYMIKTMKKSETKVLLRMLAAYYNHVRAFENTLVIRFYGLH
CVKLTGPIQKKVRFVIMGNLFCSEYSIHRRFDLKGSSLGRTTDKPESEINSNTILKDLDL
NFIFRLQKAWYQEFIRQVDKDCEFLEQERIMDYSLLVGIHFREASVAGELIPSGARTPIG
EFEDESAPRLSRADVDQLLSDPTRWASIRLGGNMPARAERTMRRSDCEFQLVGEPTGEYY
EVVMIFGIIDILQDYDISKKLEHAYKSIQYDPTSISAVDPRLYSRRFRDFIFKVFTEDN

Other information
Ka divergence:-0.174307KaKs divergence:-0.0248042
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):2319Length 2 (bp):2340Length divergence:0.005
MFE 1 (kcal):-711.61MFE 2 (kcal):-733.99MFE divergence0.015