Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41310-AT3G57040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):response regulator 3
Function (paralog2):response regulator 9

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.94427397464366
Log2 mRNA fold difference:0.59816028645252
Log2 TE fold difference:0.41057856893414
Sequences
Protein sequence

MVMETESKFHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDNDPNAL
STSPQIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCL
EEGAEEFFLKPVKLADLTKLKPHMMKTKLKKESEKPVAIEEIVVSKPEIEEEEEESSVIE
ILPLHQEIESEQLEPMLSSNKRKAMEEVVSTDRSRPKYNDITTSV

MGMAAESQFHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQSTDSNDPN
AFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISR
CLEEGAEEFFLKPVRLADLNKLKPHMMKTKLKNQKLEEIETTSKVENGVPTAVADPEIKD
STNIEIEILPLQQDLLLVQQEEQTLSINNKRKSVEEGISTDRARPRFDGIATAV

www.000webhost.com

Other information
Ka divergence:-0.0532286KaKs divergence:-0.292074
GC content 1 (%):38GC content 2 (%):39GC content divergence:0.013
Length 1 (bp):678Length 2 (bp):705Length divergence:0.02
MFE 1 (kcal):-156.91MFE 2 (kcal):-180.21MFE divergence0.069