Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41330-AT3G57070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glutaredoxin family protein
Function (paralog2):Glutaredoxin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1543276904484
Log2 mRNA fold difference:2.1891914430707
Log2 TE fold difference:-0.072144877525261
Sequences
Protein sequence

MGSSVSKTASSASASSITSILNSPPETEFNIPSSSVPKAFTFPMPSIHHPPAKKGDTHHF
VSLTSTTYGSLVLDDRQTLPHISVSGKSNKKMPETEEARDSFSPDSVINTWELMNDLDDE
FDSANSDTSKSNSVVNLDSFSKPITNRDVVINGSAYGSYEDEEDWRLLPFKPKQPLWKHM
SEESFLSDLDPNIISSYKRALSSKQLGKNSSNGHSNHSVLVSLPEYVSSSPLSSQTSEKD
QEKPRLLEKEDNENKIVVYFTSLRGIRKTYEDCCCVRAILRGFQVAVEERDISMDSKYRK
ELQNALGEEKPVCLPQVFIRGVRIGGIEEIKILNDGGELAEMLKDFPACESIGACDSCGD
ARFVPCTNCGGSTKVFEEQEDGFKRCNGCNENGLVRCNKCCL

MGSSASKTASSVSSASSSSAFSPPPTKFSSDSSSPAVQRAFSFPTPLVHHPPARKGDSHH
LVSLTSTSYGSLLLLDLDGSKNSSSDQQTLPRISISGKNTPDPVSPDSVINTWELMDGLD
DEFEFEIPKPGKRLNSDFCSKPDPNRNVSLNGSSLKLDESYEIVRIEEDDGDWVPLTYKP
KQPLWKHLSEESFLSDLDPSIVSSYKKALSSKLLSNHSNTRNPHRPTKSLSCSPSSNPSI
LISEEPKSVSSSQLISSPAKPRLPGTEDKIVLYFTTLRGIRKTYEDCCCVRAILRGVQVS
VDERDISMDSKYRKELQSVLGAAEKPVCLPQVFIRGTHIGGVEEIMQLNDGGELAEMLKD
FPACERLGTCRSCGDARFVPCTNCDGSTKVFEEQDERFKRCPKCNENGLVRCRVCCL

Other information
Ka divergence:-0.0980104KaKs divergence:0.200828
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1209Length 2 (bp):1254Length divergence:0.018
MFE 1 (kcal):-326.95MFE 2 (kcal):-369.67MFE divergence0.061