Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41340-AT3G57080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA polymerase II fifth largest subunit, D
Function (paralog2):Eukaryotic rpb5 RNA polymerase subunit family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.31333274147086
Log2 mRNA fold difference:-0.029630535197111
Log2 TE fold difference:-0.28826274701841
Sequences
Protein sequence

MEGKGKEIVVGHSISKSSVECHKYYLARRTTMEMLRDRGYDVSDEDINLSLQQFRALYGE
HPDVDLLRISAKHRFDSSKKISVVFCGTGIVKVNAMRVIAADVLSRENITGLILVLQSHI
TNQALKAVELFSFKVELFEITDLLVNVSKHVLRPKHQVLNDKEKESLLKKFSIEEKQLPR
LSSKDPIVRYYGLETGQVMKVTYKDELSESHVTYRCVS

MEVKGKETASVLCLSKYVDLSSEESHRYYLARRNGLQMLRDRGYEVSDEDINLSLHDFRT
VYGERPDVDRLRISALHRSDSTKKVKIVFFGTSMVKVNAIRSVVADILSQETITGLILVL
QNHVTNQALKAIELFSFKVEIFQITDLLVNITKHSLKPQHQVLNDEEKTTLLKKFSIEEK
QLPRISKKDAIVRYYGLEKGQVVKVNYRGELTESHVAFRCVW

www.000webhost.com

Other information
Ka divergence:-0.11559KaKs divergence:0.128387
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):657Length 2 (bp):669Length divergence:0.009
MFE 1 (kcal):-185.3MFE 2 (kcal):-194.66MFE divergence0.025