Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41370-AT3G57130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ankyrin repeat family protein / BTB/POZ domain-containing protein
Function (paralog2):Ankyrin repeat family protein / BTB/POZ domain-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.41608278597528
Log2 mRNA fold difference:-1.6224667554207
Log2 TE fold difference:2.1334692673885
Sequences
Protein sequence

MSNLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDS
PQPVTGIDPTQHGSVPASPTRGSTAPAGIIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHE
PRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVMKV
LIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVTKIEELRLKSSIARRSLMPHN
HHHDLSVAQDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSREVV
KALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPLDILR
TLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNQNNDNNTGIYPHM
NEEHNSGSSGGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHNSQREGMSRHHHHHQDPS
TMYHHHHQHHF

MSNTFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESD
PSQPGAEPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEPRSNC
GDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASR
KQDMHQLWTTCSYLIAKSGLPQEILAKHLPIELVAKIEELRLKSSMPLRSLMPHHHDLTS
TLDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREVVKALLELG
AADVNYPAGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILRTLTSDFL
FKGAIPGLTHIEPNKLRLCLELVQSAALVISREEGNNNSNDNNTMIYPRMKDEHTSGSSL
DSRLVYLNLGATNRDIGDDNSNQREGMNLHHHHHDPSTMYHHHHHHF

www.000webhost.com

Other information
Ka divergence:0.457315KaKs divergence:-0.988485
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1476Length 2 (bp):1404Length divergence:-0.025
MFE 1 (kcal):-474.39MFE 2 (kcal):-408.52MFE divergence-0.075