Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41490-AT3G57220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-glcnac-adolichol phosphate glcnac-1-p-transferase
Function (paralog2):Glycosyl transferase family 4 protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.80406327702127
Log2 mRNA fold difference:0.85798764116788
Log2 TE fold difference:-0.077964896483298
Sequences
Protein sequence

MAARKRASSISIPNKPDPSEPNSAPSEQKMTRKTVSASGEEFRLAPPKLGVIFVISTLLC
SLYLYLLCFHYKVDNELKRSILINAGLSLVGFFVTLKMIPVTARYVLRRNMFGFDINKRG
TPQGDIKVPESLGIVVGIVFLIVAIIFQYFNFTEDSNWLVEYNAALASICFMILLGFVDD
VLDVPWRVKLVLPSFATLPLLMAYAGHTTIVIPKPLVAYIGLEVLNLGRIYKLYMGLLAV
FCTNSINIHAGLNGLEIGQTVVIAAAILIHNVMQIGASVDPEYHQAHAFSIFLTQPLMAT
SLAMLAYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLA
GIVKCPRHRLPRYDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCF
ILRHFLAGWYK

MTARKRTPSVSNSEKLALPEPASSPTVQKTSVSGEDFQLAPPKLGVIFVISSLLCSLYLY
LLCFHYNVDNELKRPILINAGLSLVGFFVTLKLIPVAARYVLRRNMFGFDINKRGTPQGE
VRVPESLGIVVGIVFLIVAIVFQFFNFTEDSVWLVEYNAALASICFMILLGFVDDVLDVP
WRVKLLLPSFATLPLLMAYAGHTTIVIPKPLVSYIGLEVFDLGRIYKLYMALLAVFCTNS
INIHAGLNGLEIGQTVVIAAAILIHNVMQIGASVDTEYHQAHAFSIYLTQPLMATSLAML
AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC
PRHRLPKYDPATGLLTGTKDGTLVNVYLRIFGRKTEKSLCIHLLVFQALACAFCFMLRHF
LAGWYK

Other information
Ka divergence:-0.296672KaKs divergence:0.160839
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1296Length 2 (bp):1281Length divergence:-0.006
MFE 1 (kcal):-366.2MFE 2 (kcal):-367.41MFE divergence0.002