Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41560-AT3G57330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):autoinhibited Ca(2+)-ATPase, isoform 4
Function (paralog2):autoinhibited Ca2+-ATPase 11

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.4020752909063
Log2 mRNA fold difference:-1.2849902430484
Log2 TE fold difference:-0.047171385157702
Sequences
Protein sequence

MSNLLRDFEVEAKNPSLEARQRWRSSVSIVKNRTRRFRNIRDLDKLADYENKKHQIQEKI
RVAFFVQKAALHFIDAAARPEYKLTDEVKKAGFSIEADELASMVRKNDTKSLAQKGGVEE
LAKKVSVSLSEGIRSSEVPIREKIFGENRYTEKPARSFLMFVWEALHDITLIILMVCAVV
SIGVGVATEGFPRGMYDGTGILLSILLVVMVTAISDYKQSLQFRDLDREKKKIIVQVTRD
GSRQEISIHDLVVGDVVHLSIGDQVPADGIFISGYNLEIDESSLSGESEPSHVNKEKPFL
LSGTKVQNGSAKMLVTTVGMRTEWGKLMETLVDGGEDETPLQVKLNGVATIIGKIGLSFA
VLTFVVLCIRFVLDKATSGSFTNWSSEDALTLLDYFAISVTIIVVAVPEGLPLAVTLSLA
FAMKKLMSDRALVRHLAACETMGSSTCICTDKTGTLTTNHMVVNKVWICDKVQERQEGSK
ESFELELSEEVQSTLLQGIFQNTGSEVVKDKDGNTQILGSPTERAILEFGLLLGGDFNTQ
RKEHKILKIEPFNSDKKKMSVLIALPGGGARAFCKGASEIVLKMCENVVDSNGESVPLTE
ERITSISDIIEGFASEALRTLCLVYKDLDEAPSGELPDGGYTMVAVVGIKDPVRPGVREA
VQTCQAAGITVRMVTGDNISTAKAIAKECGIYTEGGLAIEGSEFRDLSPHEMRAIIPKIQ
VMARSLPLDKHTLVSNLRKIGEVVAVTGDGTNDAPALHEADIGLAMGIAGTEVAKENADV
IIMDDNFKTIVNVARWGRAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLL
WVNMIMDTLGALALATEPPNEGLMKRAPIARTASFITKTMWRNIAGQSVYQLIVLGILNF
AGKSLLKLDGPDSTAVLNTVIFNSFVFCQVFNEINSREIEKINVFKGMFNSWVFTWVMTV
TVVFQVIIVEFLGAFASTVPLSWQHWLLSILIGSLNMIVAVILKCVPVESRHHHDGYDLL
PSGPSSSNSA

MSNLLKDFEVASKNPSLEARQRWRSSVGLVKNRARRFRMISNLDKLAENEKKRCQIQEKI
RVVFYVQKAAFQFIDAGARPEYKLTDEVKKAGFYVEADELASMVRNHDTKSLTKIGGPEG
IAQKVSVSLAEGVRSSELHIREKIYGENRYTEKPARSFLTFVWEALQDITLIILMVCAVV
SIGVGVATEGFPKGMYDGTGILLSIILVVMVTAISDYKQSLQFRDLDREKKKIIIQVTRD
GSRQEVSIHDLVVGDVVHLSIGDQVPADGIFISGYNLEIDESSLSGESEPSHVNKEKPFL
LSGTKVQNGSAKMLVTTVGMRTEWGKLMDTLSEGGEDETPLQVKLNGVATIIGKIGLGFA
VLTFVVLCIRFVVEKATAGSITEWSSEDALTLLDYFAIAVTIIVVAVPEGLPLAVTLSLA
FAMKQLMSDRALVRHLAACETMGSSTCICTDKTGTLTTNHMVVNKVWICENIKERQEENF
QLNLSEQVKNILIQAIFQNTGSEVVKDKEGKTQILGSPTERAILEFGLLLGGDVDTQRRE
HKILKIEPFNSDKKKMSVLTSHSGGKVRAFCKGASEIVLKMCEKVVDSNGESVPLSEEKI
ASISDVIEGFASEALRTLCLVYTDLDEAPRGDLPNGGYTLVAVVGIKDPVRPGVREAVQT
CQAAGITVRMVTGDNISTAKAIAKECGILTAGGVAIEGSDFRNLPPHEMRAILPKIQVMA
RSLPLDKHTLVNNLRKMGEVVAVTGDGTNDAPALHEADIGLAMGIAGTEVAKENADVIIM
DDNFATIVNVAKWGRAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLLWVN
MIMDTLGALALATEPPNEGLMKRQPIGRTASFITRAMWRNIIGQSIYQLIVLGILNFAGK
QILNLNGPDSTIVLNTIIFNSFVFCQVFNEVNSREIEKINVFEGMFKSWVFVAVMTATVG
FQVIIVEFLGAFASTVPLSWQHWLLCILIGSVSMILAVGLKCIPVESNRHHDGYELLPSG
PSDSA

Other information
Ka divergence:-0.0746425KaKs divergence:-0.266536
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):3093Length 2 (bp):3078Length divergence:-0.002
MFE 1 (kcal):-973.27MFE 2 (kcal):-961.86MFE divergence-0.006