Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41620-AT3G57350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleoporin interacting component (Nup93/Nic96-like) family protein
Function (paralog2):Nucleoporin interacting component (Nup93/Nic96-like) family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.84562131417631
Log2 mRNA fold difference:-0.79073080838044
Log2 TE fold difference:-0.051832085580064
Sequences
Protein sequence

MANDQEMSGWTDLLHSSSKLLEQAAPSSQFPPLQRNLDQLEALSKKLKAKTLRNEAPSQS
IAATRLLAREGINAEQLARDLKSFELKTTFEDVFPAEATSVEEYLQQVHEMAMVSAIQEA
QKDNVRSFNDYMMKVLEEDWRKEKRDFLQSLSRISMLPKTNMIDTSREAHAGQLVPVGSS
PRVSSTPGKELVALANIPIHEKKAYVYGEVVKKLNTSRERGMPFRPAMCFKDAYDTLGAE
VTRGKSVNMQKIWQLVQAITGEDSAVRQGVSKRMALAIGARHHLQHGHEKFIMDTIQTHP
TQAALGGSVGNLQRIRAFLRIRLRDYGVLDFDSTDARRQPPVDTTWQQIYFCLRTGYYEE
AREIARSTRSSQQFAPLLTEWITTDGMVAAESAAIASEECEKMLRMGDRLGRTAYDKKKL
LLYTIISGSRRQIERILRDLSTLFNTIEDFLWFKLSCIRDVTGGSSSVVLNDGLAPYSLD
DLQAYLNKFEPSYYTKNGKDPLVYPYVLLLSVQLLPAIMHLSKEAGDGGYNIDAVHIAIS
LVDHSVLSEGSGTGHKLSVMDSNAEASSMIRQYGSMFLHHGDLQMTVEYYAQAAATVGGG
QLAWSGRSNVDQQRQRNLMLKQLLTEILLRERGIYFLLGARGSGEEGQLGRFFPDSRLRQ
QFLVEAAHQCQEAGLYDKSIELQKRVGAFSAALETINKCLSEAICSLARGRLDGESRTSG
LILAGNDILETYKYYPEVSLQERERVMEQETILRELEAILSIHKLGRLGNHLDALREIAK
LPFLHLDPRMPDATADVFQSASPYFQTCVPDLLKVALTCLDNVPDTDGSIRAMRSKIAGF
LASNTHRNWPRDLYEKVARSF

MANDQEMSGWTDLLHSSTKLLEQAAPSSQFPPLQRNLDQLEALSRKLKAKTLRNEAPSQS
IAATRLLAREGINADQLSRDLKSFELKTTFEDVFPAETTSVEEYLQQVHEMAMVSAIQEA
QKDNVRSFNNYMLKVLEEDCIKEKRDFLHSLSKTSMLPKTKMINSSRGSHAGSLVPLSPQ
VSSKPGTELVSMTNKPIHEKKAYVYAEVVKKLNSARERGLPFKLATLFNGAYESLEIDLT
RGKSVNMQKLWQLIQGMTGEESAVQHGVSKRMALVIGARRHLECGHGKHIMDTIQSHPTQ
AALGGSVGNLQRIRAFLRIRLRDYGSLDFDSVDARRQPPVDTTWQQIYFCLRTGYYEEAR
EIAQSSRSSQQQFAPLLTEWITTGGTVAAQTAATASEECEKLLRMGDRFGQTTYDKKKLL
LYTIISGSRRQIDRIMRDFSTLFNTIEDFLWFKLSCVRDVAGGSSSMIVNDGLVPYSLDD
LQAYLNKFEPSYYTKNGKDPLVYPYVLLLSIQLLPAIMHMSNEAGDEGYNIDAVHVAISL
VDHSILSEGSGTGRKLSVMDANAEASSMIRQYGSMYLHHGDLQMTLEYYAQAAIAVGGGQ
QAWSGRSNVDQQRQRNLMLKQLLTEILSQEDGIHFLLGARGSGEEGELGRFLPDIKLRQQ
FLIEAAHQFQEAGLYDKSIELQKRVGAFSSALETINKCLSEAICSLVRGRPDGESRTEGL
VLSGNDILNSYKYHPDVSAQERHLVMEQETILRELEAILSIHKLARLNKHLDAIREVAKL
PFLHLDPRQPDTTSDEFQKASSYFQTCVPDLLKVALTCLDNVADTDGSIRGMRSKIAGFL
ASNTQRNWPRDLYEKIARSF

www.000webhost.com

Other information
Ka divergence:0.289818KaKs divergence:0.55385
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2586Length 2 (bp):2583Length divergence:-0.001
MFE 1 (kcal):-815.59MFE 2 (kcal):-770.9MFE divergence-0.028