Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41640-AT3G57380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glycosyltransferase family 61 protein
Function (paralog2):Glycosyltransferase family 61 protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.507229554161
Log2 mRNA fold difference:-1.3563072031
Log2 TE fold difference:-0.33998054604944
Sequences
Protein sequence

MVQYQRLIIHHGRKEDKFRVSSAEESGGGGCCYSKRAKQKFRCLLFLSILSCCFVLSPYY
LFGFSTLSLLDSFRREIEGLSSYEPVITPLCSEISNGTICCDRTGLRSDICVMKGDVRTN
SASSSIFLFTSSTNNNTKPEKIKPYTRKWETSVMDTVQELNLITKDSNKSSDRVCDVYHD
VPAVFFSTGGYTGNVYHEFNDGIIPLFITSQHYNKKVVFVIVEYHDWWEMKYGDVVSQLS
DYPLVDFNGDTRTHCFKEATVGLRIHDELTVNSSLVIGNQTIVDFRNVLDRGYSHRIQSL
TQEETEANVTALDFKKKPKLVILSRNGSSRAILNENLLVELAEKTGFNVEVLRPQKTTEM
AKIYRSLNTSDVMIGVHGAAMTHFLFLKPKTVFIQIIPLGTDWAAETYYGEPAKKLGLKY
VGYKIAPKESSLYEEYGKDDPVIRDPDSLNDKGWEYTKKIYLQGQNVKLDLRRFRETLTR
SYDFSIRRRFREDYLLHRED

MVQYKRLIKKGEKHRLSVEEGGSGASAVTVSGGVYSKTAKQKLLLTIFLSLLSCCYIFSF
SSFSLLGAFSRESKGFGPYELFIAPLCSGTSNGTICCDRTGSRSDVCIMKGDVRTHSASS
SVFLFTSLKNKTKITKKIKPYTRKWETSVMQTVQELNLVYRDEENNSLVVSSVNDICDVF
YNVPAVFFSTGGYTGNVYHEFNDGIIPLFITSHHFNKKVVFVIVEYHSWWIMKYGDIVSQ
LSDYPPVDFNGDKRTHCFKEAIVGLKIHDELTVESSLMLGNKTILDFRNVLDQAYWPRIH
GLIQEEELKAANKTEDGFKKPILVILSRNGSREILNESLLVELAEEIGFIVHVLRPDKTT
ELAKIYRCLNSSDVMIGVHGAAMTHLLFLKPKTVFIQIIPIGTEWAAETYYGKPAKKMRL
KYIGYKIKPKESSLYDEYGIDDPIIRDPKSFTQKGWDYTKKIYLERQNVKLDLKRFRKPL
SRAYDFSMKRIGLVYISHKPDVTN

Other information
Ka divergence:0.0987388KaKs divergence:0.410022
GC content 1 (%):42GC content 2 (%):39GC content divergence:-0.037
Length 1 (bp):1503Length 2 (bp):1515Length divergence:0.004
MFE 1 (kcal):-440.84MFE 2 (kcal):-412.57MFE divergence-0.033