Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41770-AT3G57420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF288)
Function (paralog2):Protein of unknown function (DUF288)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.042700542316266
Log2 mRNA fold difference:0.10224877747754
Log2 TE fold difference:-0.11253038940098
Sequences
Protein sequence

MLVQDRAAPSPAKPPKSQIRELPTHQQIRRRFSEPKNLDFSTWFSENLSRIAVFSLLIVT
IVAFFFLYNTTDTASLLCFQSQSTQFLQSLSRPQIKWNSIPVVPDKTSPYANFQTEKWIV
VSVTKYPTEELKSLVKIRGWQVLAIGNSATPKDWSLKGSIFLSLDAQAELGYRVLDHLPY
DSFVRKSVGYLFAIQHGAKKIYDADDRGEVIDGDLGKHFDVELVGLDSKQEPILQYSHEN
PNRTVVNPYIHFGQRSVWPRGLPLENVGEINHEEYYTEVFGGKQFIQQGISNGLPDVDSV
FYFTRKTTLEAFDIRFDEHSPKVALPQGVMVPVNSFNTLYHSSAFWGLMLPVSVSSMASD
VLRGYWGQRLLWELGGYVAVYPPTAHRFDRIEAYPFVEEKDLHVNVGRLIKFLLAWRSEK
HSFFETVLDLSFAMAEEGFWTEQDLKFTAAWLQDLIAVGYQQPRLMSLELDRPRASIGHG
DRKEFVPRKLPSVHLGVEETGTVSTEIGNLIRWRKNFGNVVLVMFCNGPVERTALEWRLL
YGRIFKTVVILSSQKNSDLYVEEAKLDHIYKHLPKIFDRYSSAEGFLFVEDDTVLNYWNL
LQADKSKIWTTDKVSKSWTSVKPTGNSDWFSVQAELVKKTVSTMPAHFQVNYKDATKNNH
ETLTVCSSEVFYVPKRLVTDFIDLVDLVGDMDLHYKVAVPMFFLSMDSPQNFDPVLGSMV
YKRKSASFNTSSSLYSAKAPAVHPWSISSEQDFIKLVQQMAEGDPLLMELV

MLVQDRVAPKPPKSRIRELPSRDRFAEPKILDFSSWVSDNVYRIVIIFLFIVTVAAFFFL
YNTTDTASLLCFQSQSTQSLQSLTRPQINWNSIQIVSDKTSPYASFRTEKWIVVSVTKHP
TEELKGLVKIKGWQVLAIGNSLTPKDWNLKGAIFLSLDAQAELNYRILDHLPYDSFVRKS
VGYLFAIQHGAKKIFDADDRGEVIDGDLGKHFDVELVGEDARQEPILQYSHENPNRTVVN
PYIHFGQRSVWPRGLPLENVGEINHEEYYTEVFGGKQFIQQGISNGLPDVDSVYYSTRKT
TFEPFDIRFDEHSPKVALPQGMMVPVNSFNTLYHSSAFWGLMLPVSVSSMASDVIRGYWG
QRLLWELGGYVAVYPPTVHRYDRVEAYPFSDEKDLHINVGRLIKFLLAWRSNKHRFFETI
LDLSFVMAEQGFWTELDVKFTAAWLQDLLMVGYQQPRLMSLELDRPRATIGHGDRKEFVP
RKLPSVHLGVEEIGTVSSEIGNLIKWRKNFGNVVLIMFCNGPVERTALEWRLLYGRIFKT
VVILSSRKNSDLYVQEAKLDHIYKRLPKIFDRYSSADGFVFVEDDTVLNYWNLLQADKTK
LWTTDKVTESWTTVRPAGNSDWYSVQAELVKKIVSTMPVHFQVNYKEATKNSDGTSLTMC
SSEVFYVPKRFVSDFTDLVNLVGDMDLHYKVAVPMFFLSMDSPQNFDPVLGSMVYKSEPA
SLNSSLSLYSAEAPAVHPWSISNEQDFIKLVREMAEGDPLLMELV

Other information
Ka divergence:0.0409007KaKs divergence:-0.027689
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2316Length 2 (bp):2298Length divergence:-0.004
MFE 1 (kcal):-699.48MFE 2 (kcal):-705.74MFE divergence0.004