Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41790-AT3G57470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Insulinase (Peptidase family M16) family protein
Function (paralog2):Insulinase (Peptidase family M16) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.85853544522068
Log2 mRNA fold difference:-1.3485558896297
Log2 TE fold difference:0.48192945007144
Sequences
Protein sequence

MAVEKSNTTVGGVEILKPRTDNREYRMIVLKNLLQVLLISDPDTDKCAASMSVSVGSFSD
PQGLEGLAHFLEHMLFYASEKYPEEDSYSKYITEHGGSTNAYTASEETNYHFDVNADCFD
EALDRFAQFFIKPLMSADATMREIKAVDSENQKNLLSDGWRIRQLQKHLSKEDHPYHKFS
TGNMDTLHVRPQAKGVDTRSELIKFYEEHYSANIMHLVVYGKESLDKIQDLVERMFQEIQ
NTNKVVPRFPGQPCTADHLQILVKAIPIKQGHKLGVSWPVTPSIHHYDEAPSQYLGHLIG
HEGEGSLFHALKTLGWATGLSAGEGEWTLDYSFFKVSIDLTDAGHEHMQEILGLLFNYIQ
LLQQTGVCQWIFDELSAICETKFHYQDKIPPMSYIVDIASNMQIYPTKDWLVGSSLPTKF
NPAIVQKVVDELSPSNFRIFWESQKFEGQTDKAEPWYNTAYSLEKITSSTIQEWVQSAPD
VHLHLPAPNVFIPTDLSLKDADDKETVPVLLRKTPFSRLWYKPDTMFSKPKAYVKMDFNC
PLAVSSPDAAVLTDIFTRLLMDYLNEYAYYAQVAGLYYGVSLSDNGFELTLLGYNHKLRI
LLETVVGKIANFEVKPDRFAVIKETVTKEYQNYKFRQPYHQAMYYCSLILQDQTWPWTEE
LDVLSHLEAEDVAKFVPMLLSRTFIECYIAGNVENNEAESMVKHIEDVLFNDPKPICRPL
FPSQHLTNRVVKLGEGMKYFYHQDGSNPSDENSALVHYIQVHRDDFSMNIKLQLFGLVAK
QATFHQLRTVEQLGYITALAQRNDSGIYGVQFIIQSSVKGPGHIDSRVESLLKNFESKLY
EMSNEDFKSNVTALIDMKLEKHKNLKEESRFYWREIQSGTLKFNRKEAEVSALKQLQKQE
LIDFFDEYIKVGAARKKSLSIRVYGSQHLKEMASDKDEVPSPSVEIEDIVGFRKSQPLHG
SFRGCGQPKL

MLFYASEKYPEEDSYSKYITEHGGSTNAYTSSEDTNYHFDINTDSFYEALDRFAQFFIQP
LMSTDATMREIKAVDSEHQNNLLSDSWRMAQLQKHLSREDHPYHKFSTGNMDTLHVRPEE
NGVDTRSELIKFYDEHYSANIMHLVVYGKENLDKTQGLVEALFQGIRNTNQGIPRFPGQP
CTLDHLQVLVKAVPIMQGHELSVSWPVTPSISHYEEAPCRYLGDLIGHEGEGSLFHALKI
LGWATGLYAGEADWSMEYSFFNVSIDLTDAGHEHMQDILGLLFEYIKVLQQSGVSQWIFD
ELSAICEAEFHYQAKIDPISYAVDISSNMKIYPTKHWLVGSSLPSKFNPAIVQKVLDELS
PNNVRIFWESNKFEGQTDKVEPWYNTAYSLEKITKFTIQEWMQSAPDVNLLLPTPNVFIP
TDFSLKDLKDKDIFPVLLRKTSYSRLWYKPDTKFFKPKAYVKMDFNCPLAVSSPDAAVLS
DIFVWLLVDYLNEYAYYAQAAGLDYGLSLSDNGFELSLAGFNHKLRILLEAVIQKIAKFE
VKPDRFSVIKETVTKAYQNNKFQQPHEQATNYCSLVLQDQIWPWTEELDALSHLEAEDLA
NFVPMLLSRTFVECYIAGNVEKDEAESMVKHIEDVLFTDSKPICRPLFPSQFLTNRVTEL
GTGMKHFYYQEGSNSSDENSALVHYIQVHKDEFSMNSKLQLFELIAKQDTFHQLRTIEQL
GYITSLSLSNDSGVYGVQFIIQSSVKGPGHIDSRVESLLKDLESKFYNMSDEEFKSNVTN
LIDMKLEKDKNLDEESWFYWAEIQTGTLKFNRIDAEVAALRLLKKDEWIDFFDEYIKVDA
PNKKSLSICVYGNQHLKEMRNDKDKIPSTSIEIEDIVCFRKSQPLYGSLKL

Other information
Ka divergence:0.473285KaKs divergence:0.354212
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):2913Length 2 (bp):2676Length divergence:-0.042
MFE 1 (kcal):-850.12MFE 2 (kcal):-739.35MFE divergence-0.07