Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41840-AT3G57490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein S5 family protein
Function (paralog2):Ribosomal protein S5 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.9950636287141
Log2 mRNA fold difference:-2.4264419683194
Log2 TE fold difference:-0.63199806118299
Sequences
Protein sequence

MAERGGERGVERGGERGDFGRGFGGRGGRGDRGGRGRGGRGGRRGGRASEEEKWVPVTKL
GRLVAAGHIKQIEQIYLHSLPVKEYQIIDMLIGPTLKDEVMKIMPVQKQTRAGQRTRFKA
FVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTG
KCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQK
TYGFLTPEFWKETRFSRSPYQEHTDFLASKALSTSKPDPVVEDQA

MAERGVERGGDRGDFGRGFGGRGGGRGGPRGRGRRAGRAPEEEKWVPVTKLGRLVKEGKI
TKIEQIYLHSLPVKEYQIIDLLVGPSLKDEVMKIMPVQKQTRAGQRTRFKAFIVVGDSNG
HVGLGVKCSKEVATAIRGAIILAKLSVVPIRRGYWGNKIGKPHTVPCKVTGKCGSVTVRM
VPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEF
WKETRFSKSPYQEHTDFLLIPPGVKISEVVVDKSVE

Other information
Ka divergence:-0.131353KaKs divergence:0.112176
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):858Length 2 (bp):831Length divergence:-0.016
MFE 1 (kcal):-302.4MFE 2 (kcal):-276.84MFE divergence-0.044