Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41870-AT3G57540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Remorin family protein
Function (paralog2):Remorin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.5354758638873
Log2 mRNA fold difference:-2.7937445292889
Log2 TE fold difference:0.27119286064871
Sequences
Protein sequence

MLTLYHQERSPDATSNDRDETPETVVREVHALTPAPEDNSRTMTATLPPPPAFRGYFSPP
RSATTMSEGENFTTISREFNALVIAGSSMENNELMTRDVTQREDERQDELMRIHEDTDHE
EETNPLAIVPDQYPGSGLDPGSDNGPGQSRVGSTVQRVKREEVEAKITAWQTAKLAKINN
RFKREDAVINGWFNEQVNKANSWMKKIERKLEERKAKAMEKTQNNVAKAQRKAEERRATA
EAKRGTEVAKVVEVANLMRALGRPPAKRSFFSFS

MLTLYGQERSPENSTTSTTDASDRRDETPSSEIVVRDIHAMTTTTELTRPQQRGSGGGYL
SPSRSIAFSDGTTSSGENFTTVSREFNALVIAGSSMDNNSNGTNQSGGHRDVIRDERNEL
TRIGENDDVGDHGQVPEEDSNPWAIVPDDYNNRDGSENNIVLASSGGQNRMVTTASVQRV
KREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKA
MEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS

www.000webhost.com

Other information
Ka divergence:-0.184917KaKs divergence:-0.280148
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):825Length 2 (bp):891Length divergence:0.038
MFE 1 (kcal):-262.4MFE 2 (kcal):-303.6MFE divergence0.073