Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41880-AT3G57550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):guanylate kinase 1
Function (paralog2):guanylate kinase

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.231189690955
Log2 mRNA fold difference:2.9604595355458
Log2 TE fold difference:0.20952307314426
Sequences
Protein sequence

MGEAPAVLVDHPENGHSNGVCVKSEPENTEITVDVGDRIFLIGGTHERNNFSIGVQIYDK
ISNNWFSPIVLGTGPKPSKGYSAFVLEQGRILVIKKGSPRNDSIWFLEVDSPYVREQKKL
LRKEVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSME
MDGVHYHFADKKVMEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGA
RSVRASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGL
ILYNDNLEECYKKLKNLLGLDGLAHVNGVEIEGINLPIEYAVSKMEDKIIIQETGKETRN
KIVVDISSLNGGAPGRTRGILVDAIKF

MGEAPAFFVDHLENGYTNGFGVKSEPKNRDTSVLIGDRSFVIGGNHEGNPLFLGVQIHDK
VTNKWSSPSVLGTGPKPCKGYSAIVLPKGRILVIKKGSASDDSIWFLEVDTPFIREQKKL
LGREVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRAPRCME
KNGVHYHFTDKTVMEKEIKDGKFLEFASVHGNLYGTSIESVEVVTDSGKRCILDIDVQGA
RSVKASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNADAEIKAGKSSGIFEH
KLYNDNLEECYKTLKNLLGINDLAPVNGVEAVEGINLPKEHTVTKMDDKILIQETGEGTK
NKMIVLDLSSINGGAPGRTRGIVLDTVKSS

www.000webhost.com

Other information
Ka divergence:-0.190839KaKs divergence:-0.172224
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1164Length 2 (bp):1173Length divergence:0.004
MFE 1 (kcal):-360.5MFE 2 (kcal):-370.24MFE divergence0.013