Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41940-AT3G58070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc finger protein 8
Function (paralog2):C2H2 and C2HC zinc fingers superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.8308782985875
Log2 mRNA fold difference:-1.8672706261318
Log2 TE fold difference:-0.98872052124151
Sequences
Protein sequence

MDETNGRRETHDFMNVNVESFSQLPFIRRTPPKEKAAIIRLFGQELVGDNSDNLSAEPSD
HQTTTKNDESSENIKDKDKEKDKDKDKDNNNNRRFECHYCFRNFPTSQALGGHQNAHKRE
RQHAKRGSMTSYLHHHQPHDPHHIYGFLNNHHHRHYPSWTTEARSYYGGGGHQTPSYYSR
NTLAPPSSNPPTINGSPLGLWRVPPSTSTNTIQGVYSSSPASAFRSHEQETNKEPNNWPY
RLMKPNVQDHVSLDLHL

MDEATGETETQDFMNVESFSQLPFIRRPKDKNPKPIRVFGKDFTGRDFSITTGQEDYTDP
YQTKNKEEEEEEDQTGDNSTDNNSISHNRRFECHYCFRNFPTSQALGGHQNAHKRERQLA
KRGVSSYFYHPDNNPYSYRHYPSWTNGPLTAARSYGGFSSGPKPSGYYTRPSYGSQLGLW
RLPPRVQGVYNSNAAFTSNGSSSSSNSTLPLLTRSQTQLSSQVGGSAAQNRMSSYGYGLS
PNVQDHVSLDLHL

www.000webhost.com

Other information
Ka divergence:0.163352KaKs divergence:0.190718
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):774Length 2 (bp):762Length divergence:-0.008
MFE 1 (kcal):-185.9MFE 2 (kcal):-207.2MFE divergence0.054