Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41960-AT3G58050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.93374605531499
Log2 mRNA fold difference:-0.99547950930277
Log2 TE fold difference:0.14937404254264
Sequences
Protein sequence

MNKYKCKTMPGLTTHMNEHYSSSGFWSEDDDGLTYDQLDQFWSELSSKARHELLRIDKQT
LFEQARKNMCCSRCLGLLLEGFAQILSAGRAAYEKRMMGPSKDNCKSNGTRKCTVAYQSP
PVHRWGGLTTTRSGCITLLDCFLTAKTFKGLQNVFESNRARERERELLYPDACGGGGRVW
LSQGIAGFGKGHGTRETCNLHTTRLSCDTLVDFWSALEEHSRQSLLRMKEEDFVERLTYR
FDCKKFCRDCRRNVIREFKELKELKRIQRDPRCTDWFCVADTAFQYEVDIDSVRADWSQY
FTENAGYHHFEWAIGTGEGESDILEFKYVGNDRSARVNGLDLRGLHECYITLRAFKKNGR
PSEISVKAHALRGQQCVHSRLVVGDGFVSIKRGECIRMFFEHAEEAEEEEDEVLIDKDGN
ELDGECLRPQKHAKSPELAREFLLDAATVIFKEQVEKAFRDGTARQNAHSIFVCLSSELL
EQRVHIACKEIVTLEKQNKLLEEEEKEKREEEERKERKRIKEREKKLRRKERLKEKEREK
EQKNPKFSDKAILPIMSREEEGSRNLDEDTNNTIRCEESGIENGDVDLSSPGSPDDQDEE
CLDGCISPRVETHSCDSTDKEIIDHEDENGCFTPRPAHKTARLWKEVQTDHSLRLSEKRR
FTEKTSFVSSSEAGYCNDRLEMSSGHFNGSDKNVRVKASKAGGSPNSSRSHEEFQCSDGR
TGERYDYHSCSCKPINGYREKVESNTSATRGMREPKSVFKSDSDLDVSKLNRANRYTQSG
YRREIRSKMNNSRNACKMDPVNVRKVLDSVEPKHSRNSSTSDVLSLTTYKAEEIKDVSPT
VKPAGTPSLCKATDKLGNGSFNNSTEVDKKMEVHITLKNDYLYSKDPMMSRSSSSNNGNI
ESSSMSDSEVASQQSEGRENLVDTQNDMPDCHEKMVEKVTEMSMDERDVLKIKNISNLPA
DNGESKLSGTPFMVPSQNMENMVPGLNTGSYLSQPQNMILPQMLNQSIPLPVFQAPSTMG
YYHQAPVSWSSASTNGLMQFPHPNHYVYTGPLGYSLNGESPLCMQYGTPLNHSAAPFFNS
GPVPIFHPFAETNTMNTVDQAQPLEPLEHSFLKEANERRFNEMPLMETPRKRCPQTDSDE
NFSLFHFGGPVALSTGSKANPARSKDGILEDFSLQFSGDHVFGDPTGNSKKEKENTVGEE
YNLFATSNSLRFSIF

MPGLAQRNNDQYSFGFWSKEIDGVSYNQLQKFWSELSPKARQELLKIDKQTLFEQARKNM
YCSRCNGLLLEGFLQIVMHGKSLHPEGSLGNSPCNKSGGSKYQYDCNAVVSNGCADEMQD
PSVHPWGGLTTTRDGSLTLLDCYLYAKSLKGLQNVFDSAPARERERELLYPDACGGGGRG
WISQGIASFGRGHGTRETCALHTARLSCDTLVDFWSALSEDTRQSLLRMKEEDFMERLRY
RICYHSSYHILNCKMNRHFVVWTIQDVLTKFDSKRFCRDCRRNVIREFKELKELKRMRRE
PRCTTWFCVANTTFQYEVSIDSVKADWRETFSENAGKYHHFEWAIGSGEGKCDILKFENV
GMNGRVQVNGLNLRGLNSCYITLRAYKLDGRWSEVSAKAHALKGQNCVHGRLVVGDGFVS
IKRGESIRRFFEHAEEAEEEEDEDMMDKDGNELDGECSRPQKHAKSPELAREFLLDAATV
IFKEQVEKAFREGTARQNAHSIFVCLTLKLLEQHLHVACKEIITLEKQVKLLEEEEKEKR
EEEERKEKKRSKEREKKLRKKERLKEKDKGKEKKNPECSDKDMLLNSSREEEDLPNLYDE
TNNTINSEESEIETGYADLSPPGSPDVQERQCLDGCPSPRAENHYCDRPDRDIKDLEDEN
VYFTNDHQKPVHQNARYWKEVQSDNALRWSDKRRYSDNASFVSRSEARYRNDRLEVPSRG
FNGSNRQLRVNASKTGGLNGIKSHEKFQCCDNRISERFDFSSCSCKPSCEYRAKVEPKTA
GSRSTREPKTISNSDSALDASKPVFQGNRYTQPDYTRELRLKSKVGVGPNPSTTRDSLHS
KQVWEPMEPKKYPRSNSYSEVTVRCSTFKAEEIEDAIVAENSSDLLSQCKVTEKLDNIKL
KDENSMESGETKNGWHLKDPMMSSTSSSDNCSSCLSEGESNTVSSNNGNTESSSTSDSED
ASQQSEGRESIVVGTQNDILIPDTTGKSKIPETPIVVTGNNMDNNSNNNMVHGLVDVQPQ
GGMFPHLLTQNLQYPVFQTASPMGYFHQAPPVSWPTGPANGLIPFPHPNPYLYTGPLGYS
MNGDPPLCLQYGSPLNHAATPFFNPGPVPVFHPFSKTNTEDQAQNLEPPLELNCLAPPET
QTVNEDSFSLFHFSGPVGLSTGSKSKPAHSKDGILRDVVGNIYTKAKESKEVEEYNLFAT
GNGLRFSLF

www.000webhost.com

Other information
Ka divergence:-0.25477KaKs divergence:-0.137784
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3648Length 2 (bp):3630Length divergence:-0.002
MFE 1 (kcal):-1070.15MFE 2 (kcal):-1079.67MFE divergence0.004