Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G41980-AT3G58040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein with RING/U-box and TRAF-like domains
Function (paralog2):seven in absentia of Arabidopsis 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.3608280012001
Log2 mRNA fold difference:-0.40306475291305
Log2 TE fold difference:1.7760479079814
Sequences
Protein sequence

MAPGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVC
TNLMYPPIHQCPNGHTLCSSCKLRVQNTCPTCRYELGNIRCLALEKVAESLEVPCRYQNL
GCQDIFPYYSKLKHEQHCRFRSYSCPYAGSECSVTGDIPTLVDHLKDDHKVDMHDGCTFN
HRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMGDENEAKKFS
YSLEVGAHSRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFSGSDKEELKLRVTGR
IWKEE

MAPGGSALKEVMESNSTGMDYEVKTAKVEVNNNKPTKPGSAGIGKYGIHSNNGVYELLEC
PVCTNLMYPPIHQCPNGHTLCSNCKLRVQNTCPTCRYELGNIRCLALEKVAESLEVPCRY
QNLGCHDIFPYYSKLKHEQHCRFRPYTCPYAGSECSVTGDIPTLVVHLKDDHKVDMHDGC
TFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMGDENEAK
KFSYSLEVGAHGRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFSGGDRQELKLRV
TGRIWKEE

www.000webhost.com

Other information
Ka divergence:-0.331086KaKs divergence:-0.113772
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):918Length 2 (bp):927Length divergence:0.005
MFE 1 (kcal):-266.36MFE 2 (kcal):-271MFE divergence0.009