Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42080-AT3G58020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chaperone DnaJ-domain superfamily protein
Function (paralog2):Chaperone DnaJ-domain superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.70668214696053
Log2 mRNA fold difference:0.60365482166161
Log2 TE fold difference:-1.3272149655735
Sequences
Protein sequence

MNAAIRAAILRPQSYSSQLKTAFFHSTPVLERKRRTSWESKANVHKKRFRRMREKQELLR
NVNAFAANMFTSWHDEFDDDGPSSRKQTSWFKKQYSKEPKGNQNNKHGPYTWGKRNFDFC
EVDEDFDVDYVFRTAFGGSRGFSFSFTHEEDEPRWRHHSSRFSNNSNRSWRSKYRLDEDE
EEEDYTSDSSDSESEPNQVSHRQALGLSPSGPLNLKDVKHAYRTCALKWHPDRHQGSTKE
AAEAKFKLCSVAYQSLCEKLSVN

MMAAIRAAILKPQDYYSHLKTALFHSTPILQRKHQSNSKARSKRFGRKKAKQDLRRNVNA
FAQHLFGIWSDGFDYSGKHTSWFEKQYSRVSKRNRNGKTHIPQHLDKRCFDFSEVDEGYQ
IEYFLKTALGGSRGFSWSNTREGGTRSGRYSNNFRKSWGSRYRLDEEEEEEEEEYEYSST
GVSDTEPNQESHRQTLGLSSSGPLNLEDVKIAYRACALKWHPDRHHTSTKNEAEEKFKLC
TVAYQSLCEKLAMN

www.000webhost.com

Other information
Ka divergence:0.261106KaKs divergence:-0.281114
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):792Length 2 (bp):765Length divergence:-0.017
MFE 1 (kcal):-229.61MFE 2 (kcal):-208.49MFE divergence-0.048