Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42130-AT3G58010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plastid-lipid associated protein PAP / fibrillin family protein
Function (paralog2):plastoglobulin 34kD

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.4608717801714
Log2 mRNA fold difference:-1.6812408587853
Log2 TE fold difference:0.16436143340734
Sequences
Protein sequence

MALIHGSVPGTSAVRLVFSTSASPSRFCLNVPVVKQGWKNSCRRRVLRAMVQETVQGSPL
VYAREMERLSAKESLLLALKDAGGFEALVTGKTTNMQRIDVNERITSLERLNPTPRPTTS
PCFEGRWNFEWFGSGSPGLLAARVIFERFPSTLANLSRMEILIKDANAKATANIKLLNSI
ESKIILSSKLTVEGPLRLKEEYVEGMLETPTVIEEAVPEQLKSALGQAATTLQQLPALIK
DTLASGLRIPLSGSFERFFMISYLDEEILIVRDTEGVPEVLTRIETPSSTVVETIEYDS

MALIQHGSVSGTSAVRLSFSSSVSPPSSSPPLSRVSLNFQSEKKSCYRRMICRAMVQDSV
QGIPSVYAREMERLSAKESLILAFNDAGGFEALVTGKITDMQKIDVNERITNLERLNPTP
RPTTSPYLEGRWSFEWFGVNTPGSLAVRVMFERFPSTLVSLSNMEIFIKDNNTKATANIK
LLNSIENKITLSSKLTIEGPLRMKEEYLEGLLESPTVIEEAVPDQLRGLLGQATTTLQQL
PEPIKDTLANGLRIPLGGTYQRFFMISYLDDEILIVRDTAGVPEVLTRVETSSPMSSSSV
VENLEYNS

www.000webhost.com

Other information
Ka divergence:0.0875178KaKs divergence:-0.177402
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):900Length 2 (bp):927Length divergence:0.015
MFE 1 (kcal):-276.7MFE 2 (kcal):-267.6MFE divergence-0.017