Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42140-AT3G58000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):VQ motif-containing protein
Function (paralog2):VQ motif-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.31876713685409
Log2 mRNA fold difference:1.4765257006828
Log2 TE fold difference:-1.46390310969
Sequences
Protein sequence

MEIEATTVQKRRSLPTIAMHKQSRTLTKSKPKIRIIHIFAPEIIKTDVANFREIVQNLTG
KQDHHHHDLPHQKGLKRNPRSRRSHDHHEVHDMNKSHGFCINSDEEEEGMVSMTWNGNGD
ESSGGFLNGLGDLDGFIQELGEFPYLPFTIDPAVASSSHLHGNVFAEPHHYA

MEATIFEKRRSSLSSIAVHKQSYSITKSKPKIRIIHIFAPEIIKTDVANFRELVQSLTGK
PDDQRTSKAKPRRDMHRLHRQVQDMINTEKLREPEHCDQEFCLNAEELSMTWNGNNGAGE
SSGGFLNGLGDFEGFIQELGEFPYLPLSSIDASASSNSSSSSHLHGGSVFSDQFA

www.000webhost.com

Other information
Ka divergence:-0.363806KaKs divergence:-0.0196171
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):519Length 2 (bp):528Length divergence:0.009
MFE 1 (kcal):-144.6MFE 2 (kcal):-144.3MFE divergence-0.001