Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42150-AT3G57980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA-binding bromodomain-containing protein
Function (paralog2):DNA-binding bromodomain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2278822790055
Log2 mRNA fold difference:1.1645737315256
Log2 TE fold difference:0.0641533677977
Sequences
Protein sequence

MAKPENDVTLTEKQTWSTWEELLLACAVHRHGTESWNSVSAEIQKLSPNLCSLTASACRH
KYFDLKSRFTQELPVPESVAEISTAPWLEELRKLRVDELRREVEQYDLSISTLQSKVKQL
EEEREMSFIKPDTETENLDLERKKERSDSGEPVPNPPVQLMNETISPDPKEIGSENTERE
EEMAGSGGGESKLAGEDSCRGSCESVEKEPTTNSERVEPVSVTELIESEDGASRGEEITS
DVQSSASLPRKGTSEPDKEDQSPTSAKDFTVESQPLISFVEILLSHPCGSHFSRRLERQE
TIEYGTIIREHVDFEIIRKRVEGGLYKSWRINFFRDLLLLVNNARVFYHRGSSEFKFAEQ
LHQLVKKQMTTTLKGLSNRDEISISPPKEEVVAIPSSKPVSSKPRMSVPNIVACRKRSAL
AAKPLLLLPPGPDKKAKKTDHVVDYDEKPVSDKDGEASGKDDDDSLIVKIMTRGRTSSTG
KVANRNDKNRDSSLNVDDSKDKVKKTDEEKKGGSKKKRAASFLRRMKVGSSDDTLKRSSA
ADSSTTGKGGGAEQRKNNSNKADNKKTPIPKIRQTNKKASPVKRSNNGRNSEREAAPSSS
SYPILAKRSRDAGEKEEASSYSPRLKKRARR

MEELLLACAVHRHGTDSWDSVASEVHKQNSTFRTLTAIDCRHKYNDLKRRFSRNLVSPGS
ADEETLAAEISSVPWLEELRKLRVDELRREVERYDLSISSLQLKVKTLEDEREKSLKTEN
SDLDRIAETKENHTESGNNSGVPVTELKNSPDPNDNSPGTGSENTNRAVKIAEPVDEEPN
RIGGEDNDEKPAREDSGRGSCESVAKESDRAEPKREGNDSPELVESMDESKGEEDTKETS
DGQSSASFPRKETVDQDQPDNKDQSLTVNKIFVESQPLSDFIEILQSHPIGSHFSRRLET
QETSDYYRIIRQHIDFEMIRSRVEEGYYKTARTKFFRDLLLLINNVRVFYGEPSPEFNAA
KQLYQLIKKQMSFKIPKQTLPPPKEDALVTSKEEVKVSSLKPTLSVPIIACRKRSSLAVR
SPASVTETLKKKTRVVPTVDEKQVSEEEEGRPSDKDEKPIVSKKMARGAAPSTAKKVGSR
NVKTSLNAGISNRGRSPNGSSVLKKSVQQKKGINTSGGSKKQSAASFLKRMKGVSSSETV
VETVKAESSNGKRGAEQRKSNSKSEKVDAVKLPAGQKRLTGKRPTIEKGSPTKKNSGVAS
KRGTASLMAKRDSETSEKETGSSTRPKKRSKR

Other information
Ka divergence:-0.0323658KaKs divergence:-0.148454
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1896Length 2 (bp):1899Length divergence:0.001
MFE 1 (kcal):-580.08MFE 2 (kcal):-570.46MFE divergence-0.008