Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42190-AT3G57930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.2006435830564
Log2 mRNA fold difference:-0.43467349819595
Log2 TE fold difference:0.3973440093844
Sequences
Protein sequence

MRRGRGKGKKQNASAREDRGSGDEEKIPAYRRRGRPQKPMKDDFEEEEEEDDEEMVEKME
VEDEDEEIDDGSVTSKDLKERKRKMSNGSNTDLTEEENGLGSKPNTDDSTRSTSIGFRQN
GSRRKSKPRRAAEAVVECNGV

MRRGRGKGKRQNATAREDRGSGEEEKIPAFRKRGRPQKPVKDEEEEEEELVKKTDEEEDK
DDDTNGSVTSKENVTENGRKRKKPVESKESNITEEENGVGSKSSTEDSMKSSSSIGFRQN
GSRRKNKPRRAAEAVVECNGV

Other information
Ka divergence:-0.120716KaKs divergence:-0.459709
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):426Length 2 (bp):426Length divergence:0
MFE 1 (kcal):-79.1MFE 2 (kcal):-70.88MFE divergence-0.055