Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42200-AT3G57920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):squamosa promoter binding protein-like 9
Function (paralog2):squamosa promoter binding protein-like 15

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.3559123248727
Log2 mRNA fold difference:-0.15621367440624
Log2 TE fold difference:-0.23885220530967
Sequences
Protein sequence

MEMGSNSGPGHGPGQAESGGSSTESSSFSGGLMFGQKIYFEDGGGGSGSSSSGGRSNRRV
RGGGSGQSGQIPRCQVEGCGMDLTNAKGYYSRHRVCGVHSKTPKVTVAGIEQRFCQQCSR
FHQLPEFDLEKRSCRRRLAGHNERRRKPQPASLSVLASRYGRIAPSLYENGDAGMNGSFL
GNQEIGWPSSRTLDTRVMRRPVSSPSWQINPMNVFSQGSVGGGGTSFSSPEIMDTKLESY
KGIGDSNCALSLLSNPHQPHDNNNNNNNNNNNNNNTWRASSGFGPMTVTMAQPPPAPSQH
QYLNPPWVFKDNDNDMSPVLNLGRYTEPDNCQISSGTAMGEFELSDHHHQSRRQYMEDEN
TRAYDSSSHHTNWSL

MELLMCSGQAESGGSSSTESSSLSGGLRFGQKIYFEDGSGSRSKNRVNTVRKSSTTARCQ
VEGCRMDLSNVKAYYSRHKVCCIHSKSSKVIVSGLHQRFCQQCSRFHQLSEFDLEKRSCR
RRLACHNERRRKPQPTTALFTSHYSRIAPSLYGNPNAAMIKSVLGDPTAWSTARSVMQRP
GPWQINPVRETHPHMNVLSHGSSSFTTCPEMINNNSTDSSCALSLLSNSYPIHQQQLQTP
TNTWRPSSGFDSMISFSDKVTMAQPPPISTHQPPISTHQQYLSQTWEVIAGEKSNSHYMS
PVSQISEPADFQISNGTTMGGFELYLHQQVLKQYMEPENTRAYDSSPQHFNWSL

www.000webhost.com

Other information
Ka divergence:0.246919KaKs divergence:0.0502092
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):1128Length 2 (bp):1065Length divergence:-0.029
MFE 1 (kcal):-373.7MFE 2 (kcal):-293.72MFE divergence-0.12