Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42230-AT3G57890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):C-CAP/cofactor C-like domain-containing protein
Function (paralog2):Tubulin binding cofactor C domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2647974381358
Log2 mRNA fold difference:0.81612083336013
Log2 TE fold difference:0.50613571926306
Sequences
Protein sequence

MTEELIDQSPPPDPDPIQNSNLIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASL
ATNHRVGSAAISDALSISDDHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLIL
FLYIQSYKKLLPRTHKDSASVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPTDEEA
HQLSYLQKHIANIISLLAEPVEGQGDDSLVLSMESLEHIGFLVHYGDKGFDVPSLSQATP
FFANSDPDMPAVPVPASQVNDWLLKDIASALESISNRISGKENGASNASDQNAAMADSSV
ALNKVSSNDRGPCIIEGVSKTSLFKQASDLKGRSVKVANCHDSVIYLLAPLRYATVYGCS
DSTIVLGAAGKAVKVEHCERVHVIVATKRICIANCRECVFFLGVNQRPLIVGDNHKLQVA
PYNTFYSHLEEHITEVGIQPTINKWNESLALGAIDPHDSLSHPTGASDKQAEPASCVDPD
QFTTFLIPNWFAGEAIGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRE
LTTAFHMYFKDWLYATGNIRQLYCLQGD

MTEEQDLIDQSPPPSAPDPEPNSSTNPNSVIHPRRVSFEHGLLPIQKLVFTDPIQTLAPV
KQKLADAASNNRVGSAAIADVLQISGDHARLVLETLGSVLHSESDPLVRAKPEEVDSVGA
DLRDLILFLYIQSYKKLLPRTHKDSAAVADVWPSTSAFDGYLSALSPIQSCNILFPVWYG
CSIESFRKQSYNLKLFSVFYSHCSLLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLL
AEPVEGEGDESLVFSMEAFEHLRFLVQFGDKGSDVSPLSQATPFFANSDPDMPAVPVPAS
QVHDWLLQNIASALESITERISGKENGPSNDQDDAMSDVCAAPNKVAPSTRGPCLIEGVS
KTSLVKQASDLRGRSVKVVNCHDSVIYLLAPLRYATVHGCSDTTIVLGAVGKAIKVEHCE
RVHVIVAAKRVCIANCRECVFFLGVNQRPLIVGDNHKLQVAPYNTFYSHLEEHMREVGLE
PTINKWDKPLALGAVDPHDSLSHPAGVADAQAESAASVDPDQFVNFLIPNWFSGAELGST
KDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFKDWLYASGNI
RQLYCLQGD

Other information
Ka divergence:-0.410141KaKs divergence:-0.361652
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1707Length 2 (bp):1830Length divergence:0.035
MFE 1 (kcal):-488.11MFE 2 (kcal):-586.14MFE divergence0.091