Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42260-AT3G57860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):uv-b-insensitive 4
Function (paralog2):UV-B-insensitive 4-like

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.3746936999208
Log2 mRNA fold difference:-0.1713086712836
Log2 TE fold difference:1.434746752642
Sequences
Protein sequence

MPEARDRIERQVDYPAAFLNRRSHGILLDEPATQHNLFGSPVQRVPSEATGGLGSIGQGS
MTGRGGLVRGNFGIRRTGGGRRGQIQFRSPQGRENMSLGVTRRGRARASNSVLPSWYPRT
PLRDISAVVRAIERRRARMGEGVGRDIETPTPQQLGVLDSLVPLSGAHLEHDYSMVTPGP
SIGFKRPWPPSTAKVHQILLDITRENTGEEDALTPEKKLLNSIDKVEKVVMEEIQKMKST
PSAKRAEREKRVRTLMSMR

MPEARDRTERPVDYSTIFANRRRHGILLDEPDSRLSLIESPVNPDIGSIGGTGGLVRGNF
TTWRPGNGRGGHTPFRLPQGRENMPIVTARRGRGGGLLPSWYPRTPLRDITHIVRAIERR
RGAGTGGDDGRVIEIPTHRQVGVLESPVPLSGEHKCSMVTPGPSVGFKRSCPPSTAKVQK
MLLDITKEIAEEEAGFITPEKKLLNSIDKVEKIVMAEIQKLKSTPQAKREEREKRVRTLM
TMR

www.000webhost.com

Other information
Ka divergence:0.461322KaKs divergence:0.0949635
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):780Length 2 (bp):732Length divergence:-0.032
MFE 1 (kcal):-246.84MFE 2 (kcal):-223.57MFE divergence-0.049