Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42290-AT3G57830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0494494685227
Log2 mRNA fold difference:-1.4079592592076
Log2 TE fold difference:0.36890906249905
Sequences
Protein sequence

MKLPSILSLVVSSIFLCMSFCSSLNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCHWS
GIVCTNGRVTTLVLFGKSLSGYIPSELGLLNSLNRLDLAHNNFSKTIPVRLFEATKLRYI
DLSHNSLSGPIPAQIKSMKSLNHLDFSSNHLNGSLPESLTELGSLVGTLNFSFNQFTGEI
PPSYGRFRVHVSLDFSHNNLTGKVPQVGSLLNQGPNAFAGNSHLCGFPLQTPCEKIKTPN
FVAAKPEGTQELQKPNPSVISNDDAKEKKQQITGSVTVSLISGVSVVIGAVSLSVWLIRR
KRSSDGYNSETKTTTVVSEFDEEGQEGKFVAFDEGFELELEDLLRASAYVIGKSRSGIVY
RVVAAESSSTVVAVRRLSDGNDTWRFKDFVNEVESIGRINHPNIVRLRAYYYAEDEKLLI
TDFINNGSLYSALHGGPSNTRPTLSWAERLCIAQGTARGLMYIHEYSSRKYVHGNLKSSK
ILLDNELHPHVSGFGLTRLVSGYPKVTDHSLSSMTQSIDQGFATRLSVSAPAAAYLAPEA
RASSDCKLSHKCDVYSFGVILLELLTGRLPYGSSENEGEEELVNVLRKWHKEERSLAEIL
DPKLLKQDFANKQVIATIHVALNCTEMDPDMRPRMRSVSEILGRIK

MQFLRLLTLLVSSYFFFFINFSSSLNPDGLSLLALKSAILRDPTRVMTSWSESDPTPCHW
PGIICTHGRVTSLVLSGRRLSGYIPSKLGLLDSLIKLDLARNNFSKPVPTRLFNAVNLRY
IDLSHNSISGPIPAQIQSLKNLTHIDFSSNLLNGSLPQSLTQLGSLVGTLNLSYNSFSGE
IPPSYGRFPVFVSLDLGHNNLTGKIPQIGSLLNQGPTAFAGNSELCGFPLQKLCKDEGTN
PKLVAPKPEGSQILPKKPNPSFIDKDGRKNKPITGSVTVSLISGVSIVIGAVSISVWLIR
RKLSSTVSTPEKNNTAAPLDDAADEEEKEGKFVVMDEGFELELEDLLRASAYVVGKSRSG
IVYRVVAGMGSGTVAATFTSSTVVAVRRLSDGDATWRRKDFENEVEAISRVQHPNIVRLR
AYYYAEDERLLITDYIRNGSLYSALHGGPSNTLPSLSWPERLLIAQGTARGLMYIHEYSP
RKYVHGNLKSTKILLDDELLPRISGFGLTRLVSGYSKLIGSLSATRQSLDQTYLTSATTV
TRITAPTVAYLAPEARASSGCKLSQKCDVYSFGVVLMELLTGRLPNASSKNNGEELVRVV
RNWVKEEKPLSEILDPEILNKGHADKQVIAAIHVALNCTEMDPEVRPRMRSVSESLGRIK
SD

Other information
Ka divergence:-0.119072KaKs divergence:-0.313524
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1941Length 2 (bp):1989Length divergence:0.012
MFE 1 (kcal):-590.46MFE 2 (kcal):-591.71MFE divergence0.001