Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42300-AT3G57800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.4832171106768
Log2 mRNA fold difference:0.98044639991325
Log2 TE fold difference:0.50557344677062
Sequences
Protein sequence

MDLTQGFRARSGVVGPVAGLESLNFSDEFRHLVTTMPPETTGGSFTALLEMPVTQAMELL
HFPDSSSSQARTVTSGDISPTTLHPFGALTFPSNSLLLDRAARFSVIATEQNGNFSGETA
NSLPSNPGANLDRVKAEPAETDSMVENQNQSYSSGKRKEREKKVKSSTKKNKSSVESDKL
PYVHVRARRGQATDNHSLAERARREKINARMKLLQELVPGCDKIQGTALVLDEIINHVQT
LQRQVEMLSMRLAAVNPRIDFNLDSILASENGSLMDGSFNAESYHQLQQWPFDGYHQPEW
GREEDHHQANFSMGSATLHPNQVKMEL

MDLTGGFGARSGGVGPCREPIGLESLHLGDEFRQLVTTLPPENPGGSFTALLELPPTQAV
ELLHFTDSSSSQQAAVTGIGGEIPPPLHSFGGTLAFPSNSVLMERAARFSVIATEQQNGN
ISGETPTSSVPSNSSANLDRVKTEPAETDSSQRLISDSAIENQIPCPNQNNRNGKRKDFE
KKGKSSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGC
DKGTDFGGKIKIKVCFGVHLLMISGKKVAIFLWKVSCEDLIDCSFSPPRIQGTALVLDEI
INHVQSLQRQVEMLSMRLAAVNPRIDFNLDTILASENGSLMDGSFNAAPMQLAWPQQAIE
TEQSFHHRQLQQPPTQQWPFDGLNQPVWGREEDQAHGNDNSNLMAVSENVMVASANLHPN
QVKMEL

www.000webhost.com

Other information
Ka divergence:-0.102602KaKs divergence:-0.206131
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):984Length 2 (bp):1281Length divergence:0.131
MFE 1 (kcal):-306.45MFE 2 (kcal):-410.65MFE divergence0.145