Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42310-AT3G57785
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.98813130693841
Log2 mRNA fold difference:-1.3940480702718
Log2 TE fold difference:0.3872718439823
Sequences
Protein sequence

MPSTQSLTVAAKTLRNRIFSRSGSTSAGPSRWATPGHEERPKGYFMNRTPPAPGQSRKWE
DWELPCYITSFLTIVILGVGLNAKPDLSIETWAHQKALERLEMEKLATAGDSSD

MASTKPLIVAAKTLRNRIHFRSGSTSTGPSRWATPGHEERPKGYFMNRTPPPPGQSRKWE
DWELPCYITSFLTIVILGVGLNAKPDLSIETWAHQKALERLEMEKLASAGDSSG

Other information
Ka divergence:0.751364KaKs divergence:0.925226
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):345Length 2 (bp):345Length divergence:0
MFE 1 (kcal):-114.3MFE 2 (kcal):-114.2MFE divergence0