Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42320-AT3G57780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nucleolar protein gar2-related
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.8963307546585
Log2 mRNA fold difference:-2.3445679897743
Log2 TE fold difference:-0.71335173991017
Sequences
Protein sequence

MKARTTNNVVQSKRSTKSVRKDQKLQKTNSQKKTEQEKHKDLDTKEESSNISTVASDSTI
QSDPSESYETVDVRYLDDDNGVIASADAHQESDSSSVVDKTEKEHNLSGSICDLEKDVDE
QECKDANIDKDAREGISADVWEDASNGALSAGSENEAADVTENNGGNFEDGSSEEKIERL
ETRIEKLEEELREVAALEISLYSVVPDHCSSAHKLHTPARRISRIYIHACKHFTQGKRAT
IARNSVSGLVLVAKSCGNDVSRLTFWLSNIIALRQIISQAFGRSRITQISEPNESGNSDS
GKKTNLRWKNGFQQLLEDWQETETFTTALEKIEFWVFSRIVESVWWQVFTPHMQSPEDDS
SASKSNGKLMGPSLGDQNQGTFSISLWKNAFRDALQRICPMRGAGHECGCLPVLARMVMD
KCIGRFDVAMFNAILRESEHQIPTDPVSDPILDSKVLPIPAGDLSFGSGAQLKNAIGNWS
RCLTEMFGMNSDDSSAKEKRNSEDDHVESKAFVLLNELSDLLMLPKDMLMEISIREEICP
SISLPLIKRILCNFTPDEFCPDQVPGAVLEELNAAESIGDRKLSEASFPYAASSVSYMPP
STMDIAEKVAEASAKLSRNVSMIQRKGYTSDEELEELDSPLTSIVDKASDFTGSATSNAR
YKLLRQVWV

MMKGRTTNNSVQSNRSTKNGKRDQKPQKTNGAKRSSEQERLKATKEESNVSVVVDDTTTQ
SKLSDDDDHAVNDSSEKTEKEETINGLACDDEDEEEKEESKELDAIAHEKTDSVSSPETC
EGVNVDKVVEVWDDASNGGLSGGSENEAGDVKEKNENFEEDEEMLKQMVETLETRVEKLE
EELREVAALEISLYSVVPDHSSSAHKLHTPARRISRIYIHACKHWSQGKRATVARNSVSG
LILAAKSCGNDVSRLTFWLSNIISLREIILQAFGKTSVPSHFTETSASNGSEHNVLGKVR
RKKNQWTKQSNGFKQVFEDWQESQTFTAALEKVEFWIFSRIVESVWWQVFTPHMQSPENG
GKTKEHILGDIEQGSFSISLWKNAFKVTLSRLCPMRGARHECGCLPILAKMVMEKCIARI
DVAMFNAILRESEHQIPTDPVSDPILDSKVLPILSGNLSFGSGAQLKNAIGNWSRCLAEM
FSINTRDSVEENDPIESEKSFSLLNELSDLLMLPKDMLMDRSTREEVCPSISLALIKRIL
CNFTPDEFCPDDVPGAVLEELNNESISEQKLSGVSFPYAASPVSYTPPSSTNVAEVGDIS
RMSRNVSMIQRKGYTSDDELEELDSPLTSIIENVSLSPISAQGRNVKQEAEKIGPGVTIS
RYELLREVWSM

www.000webhost.com

Other information
Ka divergence:0.136947KaKs divergence:0.166188
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2010Length 2 (bp):2016Length divergence:0.001
MFE 1 (kcal):-599.56MFE 2 (kcal):-580.01MFE divergence-0.017