Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42350-AT2G42360
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0648186692624
Log2 mRNA fold difference:-1.0963935181658
Log2 TE fold difference:0.074521665379167
Sequences
Protein sequence

MSSNNKTDDSDDRSFWQNSTSYDASSKIFLVTTVSFSIIIIIVFVYYLYAKFVLHRRSAF
QDLSFSVVSQPPKRGLDSLVIASLPTFVVGIKNDVAGTECAVCLSLLEEKDNARMLPNCK
HVFHVSCVDTWLTTQSTCPVCRTEAEPSHPRLEPEPREGPVGDFAPPLDFAGVDNKTGGS
SVSRLDSFRRILTRERSSNRRDHSRVDQDRELDIERQ

MSSNDRDHRRFNSDHHSFWPNPSTYDLNSKIMLAAVASLSGVILIVFALHLYARFVLRRR
REAFRGLPVIFRHPFEMPKRGLNPTVIASLPTFTVGATDGVAASATECAVCLSVLKEQDK
ARELPNCKHIFHVDCVDTWLTTCSTCPVCRTEVEPRPRLEPEPREGPVGTAPQLLVETRL
NLTVEAASSSSSDNKTVVSPASRLNSFRKILTRERSSNRINHSCPDQDRVADLERH

www.000webhost.com

Other information
Ka divergence:-0.302227KaKs divergence:-0.0142426
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):654Length 2 (bp):711Length divergence:0.042
MFE 1 (kcal):-194.96MFE 2 (kcal):-215.63MFE divergence0.05