Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42370-AT3G58110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.5417924409124
Log2 mRNA fold difference:5.1987812113663
Log2 TE fold difference:-0.62803511094732
Sequences
Protein sequence

MDPPANPFASREQDTVTILRNLIKQATLEEEVSEASETHSVPNKIRILESVSDEMRKSQE
NGSDQKQLSEEDEIDILDSKAMSFSFSCHGGGPKRKKCNDKKRKQQEEKSKKKLKVLVET
LKLVPFKPLKTLDFACYESLLKTLGLWDFVHLEFDQDMDYDLVAQLIASYSAGGKCSYIN
GSRIKLSRADLARSLKLPNKKERVVILDEDKEFLESDESISVVEDVISNWMLLHCDDAWM
MPDEVVEWMKGIKKKQLDKLDWAGLMWFMVEKELKAEPPLGDCFYASHLQMVIRSQKIDL
FKERDLKVKDDIAALNLGMDDGATDSKKENCVEESTTKLNLGQVIVSEMAATMELYHEEQ
AIDLEENKEQPMDLKEAKEEGDEMEWRQPYEKNGTRHRKVGENEILEDEIEKDGEKQEGG
FLLFRNGKTLHQENLMLGDTSTLGYNSGLQVHGSSTCDFLAPRAVMHMVPGRSHFGNDNK
REFGHENDISYHFDNPASTKRLKTPSWDDKPVPFDICMEQIKHLADKAKLSYVEKDQACG
ESNMREQMLQNELQRREDIIQQLHKESYEELHKKNVEIYKLENELRMMTSVLAWYQKALK
ESQKACRKHRKVCPLLDKPIYIDVKGTGGLVLSTAEIEKLRLKEEKEEGMRRVLIERQVK
EVGSLWIKEYEVNLKKKVELLDGKLIGFQNKMKLLKETISRRESISARFDATSNT

MASSPPSDPTDRDAETLSQNPSLIEKPSVVEQGSLSVENVAEKALNLESTQDEETQNLQD
LEESDGRDQQLEASLEESRNEEDDMDTTQAVSSSYYRRGGGPKRKKGNQKKRKQLEKSKE
KLEVLLKTLKPIAFAPCKTLDFARHEKLLKTLGLWDFVHLDFDQNIREDLVANLVAYYNS
ERRCSYVNGARINVSRPDLARALKLPMKKDFVVTEEERELLENDESVRFIDEIVSTCVLL
QRDDMWIMPVEIVEWTRDIKQKHLEKLDWPKLLWFMVEKELKAEPPLGDCFFASHLQLLI
KSQKEDLLKEKCKADDEEDDDDDDDDVKEVDFLVKSPKEDCLEVKEEDVGAADSRKDDGA
VDLKEDKYVEEHMLELNLGQETVSEMVSGEERGPVEGQPMDVEENKKEEDERWAWNGDSH
AGSHFLRRCNHSSAREGDEDNHIEGSMEMGEDEPIEDVEEEETEEDTEKHEGGFPFFPNG
DSLQGVGQGNLMLGDASPLGYNSGLQIHGNSIGGDFLASRGEMHMAMGSGSSSLFGNGNN
KREIEHENGITYHSHNPINKRLRTEEPSWDEKPPPVDMCLDQMAYWAEKARLSFAEKDRE
REQSVINQQYLMNELQSKTAMIQELERTKFEEQQRKDIMIYKLESELRMMTSVVEGYRKA
LKITQKASREHRKRCPLRDDKQVYMDVKGSGGLVLSTTEIEKLRLKQEEEDRMQRVLAKR
QIDDFEHNWLNKFEEHMEAVELLNERLIENEDEVKILRETLSESKNIETSEVAAAMEETA
TEET

Other information
Ka divergence:-0.13944KaKs divergence:-0.366602
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):2148Length 2 (bp):2355Length divergence:0.046
MFE 1 (kcal):-580.65MFE 2 (kcal):-666.98MFE divergence0.069