Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42380-AT3G58120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Basic-leucine zipper (bZIP) transcription factor family protein
Function (paralog2):Basic-leucine zipper (bZIP) transcription factor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.316353589272
Log2 mRNA fold difference:0.49373284241505
Log2 TE fold difference:0.80790897173593
Sequences
Protein sequence

MAQLPPKIPNMTQHWPDFSSQKLSPFSTPTATAVATATTTVQNPSWVDEFLDFSASRRGN
HRRSISDSIAFLEAPTVSIEDHQFDRFDDEQFMSMFTDDDNLHSNPSHINNKNNNVGPTG
SSSNTSTPSNSFNDDNKELPPSDHNMNNNINNNYNDEVQSQCKMEPEDGTASNNNSGDSS
GNRILDPKRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPRVAFLDHQRL
LLNVDNSALKQRIAALSQDKLFKDAHQEALKREIERLRQVYNQQSLTNVENANHLSATGA
GATPAVDIKSSVETEQLLNVS

MAQLPPKIPTMTTPNWPDFSSQKLPSIAATAAAAATAGPQQQNPSWMDEFLDFSATRRGT
HRRSISDSIAFLEPPSSGVGNHHFDRFDDEQFMSMFNDDVHNNNHNHHHHHSINGNVGPT
RSSSNTSTPSDHNSLSDDDNNKEAPPSDHDHHMDNNVANQNNAAGNNYNESDEVQSQCKT
EPQDGPSANQNSGGSSGNRIHDPKRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTE
VSVLSPRVAFLDHQRLLLNVDNSAIKQRIAALAQDKIFKDAHQEALKREIERLRQVYHQQ
SLKKMENNVSDQSPADIKPSVEKEQLLNV

Other information
Ka divergence:-0.13797KaKs divergence:0.51561
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):966Length 2 (bp):990Length divergence:0.012
MFE 1 (kcal):-251.86MFE 2 (kcal):-261.15MFE divergence0.018