Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42500-AT3G58500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):protein phosphatase 2A-3
Function (paralog2):protein phosphatase 2A-4

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.50668315337768
Log2 mRNA fold difference:0.31137094803415
Log2 TE fold difference:0.19528798042679
Sequences
Protein sequence

MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICG
DIHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLVALKMRYPQRITILRG
NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIET
LDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNNLKL
IARAHQLVMDGYNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCRNHTFIQFEPAPRRG
EPDVTRRTPDYFL

MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICG
DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRG
NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIET
LDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNNLKL
IARAHQLVMDGFNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCRNHTFIQFEPAPRRG
EPDVTRRTPDYFL

www.000webhost.com

Other information
Ka divergence:-0.270115KaKs divergence:-0.144543
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):942Length 2 (bp):942Length divergence:0
MFE 1 (kcal):-289.4MFE 2 (kcal):-296.7MFE divergence0.012