Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42580-AT3G58620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):tetratricopetide-repeat thioredoxin-like 3
Function (paralog2):tetratricopetide-repeat thioredoxin-like 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.5053650906382
Log2 mRNA fold difference:-2.1039667336876
Log2 TE fold difference:-0.010804999598964
Sequences
Protein sequence

MSHSRRLSLEPAIDSITGRFRDLQRNDDDVNKPDFRELDLGSPVSTLMPRGSASSSAAAT
PTSSSGSSGSASGKPSVSSQMAKRLDDAYKSHSGELSSPGSGMPTTTRILKPGHRRSSST
GTPLIFSGSSFTSATSHTSPQGGGSGATSAVSPNTGVLPAGNICPSGRILKTGMASRTSS
RTETLCTGTGNYGHGNVVRSGGGGGTSGKAVRVAENGENPEELKRMGNDMYRRGSFSEAL
SLYDRAILISPGNAAYRSNRAAALTALRRLGEAVKECLEAVRIDPSYSRAHQRLASLYLR
LGEAENARRHICFSGQCPDQADLQRLQTLEKHLRRCWEARKIGDWKTAIKETDAAIANGA
DSSPQLVACKAEAFLRLKQIEDSDFCVSCIPRLDHHYHSQPQVKLFGMVVEAYVLCIQAQ
VDMALGRFENAVVKAERAAMLDQTNPEVVSVLNNVKMVVRARTRGNELFSSGRFSEACVA
YGDGLKQDDSNSVLYCNRAACWYKLGLWEKSVEDCNHALKSQPSYIKALLRRAASYGKLG
RWEDAVKDYEFLRRELPGDSEVAESLERAKTVLMNRSQESKSLGFNNEVEAVSTLDKFKK
SVALPGVSVFHFKSSSNRQCEEISPFINTLCLRYPLVHFFMVDVEESMALAKAESIRKVP
TFKMYKNGDKVKEMVCPSHQFLEDSIKHFLL

MSHYRRHSLEPSITSKFRDSLSFQRDDDVINKPDFRELDFGSPLRPRGSSSAAATPAASG
SSSSSSGSASGKPAVTSQFARRSHSGELSGLSQTSPVKPGSVNRNLKPGHRRSASAGTPL
IYSGLGFSPVNNNNNSSRGGGSGATSPNPGVLPTGNICPSGRILKTGMATRASVRPETLC
TGTANYGHGNIIRTGGKVSHATKAAAEMSDSEEVKKAGNVMYRKGNYAEALALYDRAISL
SPENPAYRSNRAAALAASGRLEEAVKECLEAVRCDPSYARAHQRLASLYLRLGEAENARR
HLCVSGQCPDQADLQRLQTLEKHLRLCTEARKIGDWRTVISEIDAAIANGADSSPQLVAC
KAEAFLRLHQIKDSDLCISSIPRLDHHHTQPPEKLFGIVCDAYVLCVQAQVDMALGRFEN
AIVKVERAMTIDHSNSPEVVSVLNNVKNVAKARTRGNELFSSGRYSEASVAYGDGLKLDA
FNSVLYCNRAACWFKLGMWEKSVDDCNQALRIQPSYTKALLRRAASYGKLGRWEDAVRDY
EVLRKELPGDSEVAESLQRARNALSNKSEEPKYLGFNNEVEEVSTLDKFKTATSLPGISV
FHFKSSSNRQSEAISPFVNTLCLRYPLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGE
KVKEMVCPSHQLLEDSVTHFLL

Other information
Ka divergence:-0.0297926KaKs divergence:0.585989
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):2076Length 2 (bp):2049Length divergence:-0.007
MFE 1 (kcal):-713.82MFE 2 (kcal):-677.73MFE divergence-0.026