Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42650-AT3G58660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L1p/L10e family
Function (paralog2):Ribosomal protein L1p/L10e family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.3428261927129
Log2 mRNA fold difference:2.1469184441705
Log2 TE fold difference:0.2729147865421
Sequences
Protein sequence

MSRVSPKTVDDAVKALVKEGNEKSRTEKPQLLEEDGFFYLVVALKKIPQRNFTNAYRIPL
PHPLINTTEDSPELCLIIDDRPESGLTEEDAKKNIKSENIPITKVVKLSKLKSDYGSFES
KRKLCDSYDMFFSDRRVIPMLPKLIGKKFFQSKKTPVAIDLKHMNWKEQIEKACGAAMFF
MRTGSCSAIKVAKLSMESDDIVENVTATLNGVVDVLPSRWKYIRSLHLKLSESLSLPLYQ
TVPYLQLKIDPLGVEEVKNGEGLAKSDVDDSSSKSVKTKKKNGKIHEVRYMDSNVSETLG
DDEFDRSVGEDEVADDLNASGDKKKRKKMSSSKSAVSGKPDIVKSKNGQKSKKLKKDIDE
SGGGFKAKTKRR

MTTAVSPPPPQEQQLVHASQTSRVSPKTVESALNGLINWRSDKSKTEKPQLLEEDELVYL
FVTLKKIPQKTRTNAYRIPLPHPLINPTVDSPEICLIIDDRPKSGLTKDDAMKKIKSENI
PITKVIKLSKLKSDYKAFEAKRKLCDSYDMFFTDRRIIPLLPRVIGKKFFTSKKIPVALD
LKHRNWKHQIEKACGSAMFFIRTGTCSVIKVGKLSMDICEITENVMATLNGLVEFLPNKW
TYVRSLHLKLSESLALPIYQSVPDLKLKIDAFGSGKSVVQEEKEGEVEEVVAVDGGEKSV
TGKGKKKKGRIHEVRYMDSNVAEVLDEDEIGGDEDNNEIVESEEKKMKKRKKEVSEVAES
EKPMKKAAKGKLKPDVEKPMKKAAKGKSKPDVEKPMQKAAVKGKVKPDVVKLEKSKDGLK
AKKTTMVAKDESGGGLKPKRKSVLRK

www.000webhost.com

Other information
Ka divergence:-0.351974KaKs divergence:-0.386175
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1119Length 2 (bp):1341Length divergence:0.09
MFE 1 (kcal):-308.64MFE 2 (kcal):-385.54MFE divergence0.111