Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42670-AT3G58670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1637)
Function (paralog2):Protein of unknown function (DUF1637)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.33859679836006
Log2 mRNA fold difference:-0.5700399137315
Log2 TE fold difference:0.2643009599594
Sequences
Protein sequence

MPYFAQRLYNTCKASFSSDGPITEDALEKVRNVLEKIKPSDVGIEQDAQLARSRSGPLNE
RNGSNQSPPAIKYLHLHECDSFSIGIFCMPPSSMIPLHNHPGMTVLSKLVYGSMHVKSYD
WLEPQLTEPEDPSQEARPAKLVKDTEMTAQSPVTTLYPKSGGNIHCFKAITHCAILDILA
PPYSSEHDRHCTYFRKSRREDLPGELEVDGEVVTDVTWLEEFQPPDDFVIRRIPYRGPVI
RT

MPYFIQRLFNTCKSSLSPNGPVSEEALDKVRNVLEKIKPSDVGLEQEAQLVRNWPGPGNE
RNGNHHSLPAIKYLQLHECDSFSIGIFCMPPGSIIPLHNHPGMTVLSKLVYGSMHVKSYD
WAEPDQSELDDPLQARPAKLVKDIDMTSPSPATTLYPTTGGNIHCFKAITHCAIFDILSP
PYSSTHGRHCNYFRKSPMLDLPGEIEVMNGEVISNVTWLEEYQPPDNFVIWRVPYRGPVI
RK

Other information
Ka divergence:-0.0618965KaKs divergence:-0.122371
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):729Length 2 (bp):729Length divergence:0
MFE 1 (kcal):-210.3MFE 2 (kcal):-200.43MFE divergence-0.024