Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42680-AT3G58680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):multiprotein bridging factor 1A
Function (paralog2):multiprotein bridging factor 1B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.053410630353992
Log2 mRNA fold difference:0.962000279719
Log2 TE fold difference:-0.87244912662845
Sequences
Protein sequence

MAGIGPITQDWEPVVIRKKPANAAAKRDEKTVNAARRSGADIETVRKFNAGTNKAASSGT
SLNTKMLDDDTENLTHERVPTELKKAIMQARTDKKLTQSQLAQIINEKPQVIQEYESGKA
IPNQQILSKLERALGAKLRGKK

MAGIGPITQDWEPVVIRKRAPNAAAKRDEKTVNAARRSGADIETVRKFNAGSNKAASSGT
SLNTKKLDDDTENLSHDRVPTELKKAIMQARGEKKLTQSQLAHLINEKPQVIQEYESGKA
IPNQQILSKLERALGAKLRGKK

Other information
Ka divergence:-0.0704116KaKs divergence:0.179316
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):429Length 2 (bp):429Length divergence:0
MFE 1 (kcal):-114.77MFE 2 (kcal):-120.1MFE divergence0.023