Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42790-AT3G58750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):citrate synthase 3
Function (paralog2):citrate synthase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.68797493797264
Log2 mRNA fold difference:-0.27946454351125
Log2 TE fold difference:-0.40607491925056
Sequences
Protein sequence

MEISERVRARLAVLSGHLSEGKQDSPAIERWCTSADTSVAPLGSLKGTLTIVDERTGKNY
KVPVSDDGTVKAVDFKKIVTGKEDKGLKLYDPGYLNTAPVRSSISYIDGDEGILRYRGYP
IEEMAENSTFLEVAYLLMYGNLPSESQLSDWEFAVSQHSAVPQGVLDIIQSMPHDAHPMG
VLVSAMSALSIFHPDANPALRGQDIYDSKQVRDKQIIRIIGKAPTIAAAAYLRMAGRPPV
LPSGNLPYADNFLYMLDSLGNRSYKPNPRLARVLDILFILHAEHEMNCSTAAARHLASSG
VDVYTAVAGAVGALYGPLHGGANEAVLKMLSEIGTVENIPEFIEGVKNRKRKMSGFGHRV
YKNYDPRAKVIKNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLI
YRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERI
VTDDSKESDKLGQVATSNASRRRLAGSSV

MEISQRVKARLAVLTAHLAVSDTVGLEQVLPAIAPWCTSAHITAAPHGSLKGNLTIVDER
TGKKYQVPVSEHGTVKAVDLKKITTGKDDKGLKLYDPGYLNTAPVRSSICYIDGDEGILR
YRGYPIEELAESSTFIEVAYLLMYGNLPSQSQLADWEFTVSQHSAVPQGVLDIIQSMPHD
AHPMGVLVSAMSALSIFHPDANPALSGQDIYKSKQVRDKQIVRILGKAPTIAAAAYLRTA
GRPPVLPSANLSYSENFLYMLDSMGNRSYKPNPRLARVLDILFILHAEHEMNCSTAAARH
LASSGVDVYTACAGAVGALYGPLHGGANEAVLKMLAEIGTAENIPDFIEGVKNRKRKMSG
FGHRVYKNYDPRAKVIKKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDF
YSGLIYRAMGFPPEFFTVLFAVPRMAGYLSHWRESLDDPDTRIMRPQQAYTGVWMRHYEP
VRERTLSSDSDKDKFGQVSISNASRRRLAGSSAL

www.000webhost.com

Other information
Ka divergence:-0.0283549KaKs divergence:-0.0010627
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1530Length 2 (bp):1545Length divergence:0.005
MFE 1 (kcal):-516.2MFE 2 (kcal):-502.29MFE divergence-0.014