Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42870-AT3G58850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phy rapidly regulated 1
Function (paralog2):phy rapidly regulated 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.7174845220013
Log2 mRNA fold difference:-0.59350653395151
Log2 TE fold difference:-2.9305758883019
Sequences
Protein sequence

MEETLATPDATRRSLSPSCSATVKSRAAGFERRTKRRLSETNASVREDREEAEEEEDEVK
EKIEALQRIIPGGAALGVDALFEETAGYILSLQCQIKTIKVLTSFLQRIDQEDMKFGG

MEKTLATSHTKRSSPPSPSSAVNTSSTGFNRRTRQRLSDATASVSETDVEDEDEDEEGVE
EKIEALQTIVPGGTELGVDALFEETASYILALQCQINAIKVLTTFLERCEKKDMKFGG

Other information
Ka divergence:0.0491696KaKs divergence:-0.10591
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):357Length 2 (bp):357Length divergence:0
MFE 1 (kcal):-102.69MFE 2 (kcal):-108.8MFE divergence0.029