Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42960-AT3G59110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.8455425896811
Log2 mRNA fold difference:2.0681351632965
Log2 TE fold difference:0.76610314208204
Sequences
Protein sequence

MPPESSLNAEMSKKISFFGLKGLKLWVWVCLVVGVFIVMILCILSLWITFRRKSRRSSSK
FPFNQIPHVSKDIRVDRAGFQNPHPESLYIEMNDKSTGKTMMSHLGRTKSSDNDTLSQCS
SVNHHERACSSHSGEEGGFGSAGRQYGGGPVTASPLVGLPEISHLGWGHWFTLRDLELAT
NRFAPVNVLGEGGYGVVYRGKLVNGTEVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLV
RLLGYCIEGVHRMLVYEYVNSGNLEQWLHGAMRQHGNLTWEARMKIITGTAQALAYLHEA
IEPKVVHRDIKASNILIDDEFNAKLSDFGLAKLLDSGESHITTRVMGTFGYVAPEYANTG
LLNEKSDIYSFGVLLLEAITGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRLEPR
PSKSALKRALLVSLRCVDPEAEKRPRMSQVARMLESDEHPFHKERRNKRSKTAGMEIVET
KDESLGPSGSETKP

MSSESSLSADMSKKVSFLGLKGMKLWVLICLVVGTFVVLVFCILSLWIAFRRKSRRSSHK
LLPFSQIPRVAKDIRVDDRVGFQNHNENLSITNADKSSDRNSGKMMSYLGRTKSSDNDSI
SQCSSVHHHERACSSHSGEDGSFGAAWRQNSLSQGGLVTASPLVGLPEISHLGWGHWFTL
RDLQLATNRFAAENVIGEGGYGVVYKGRLINGNDVAVKKLLNNLGQAEKEFRVEVEAIGH
VRHKNLVRLLGYCIEGVNRMLVYEYVNSGNLEQWLHGAMGKQSTLTWEARMKILVGTAQA
LAYLHEAIEPKVVHRDIKASNILIDDDFNAKLSDFGLAKLLDSGESHITTRVMGTFGYVA
PEYANTGLLNEKSDIYSFGVLLLETITGRDPVDYERPANEVNLVEWLKMMVGTRRAEEVV
DSRIEPPPATRALKRALLVALRCVDPEAQKRPKMSQVVRMLESDEHPFREERRNRKSRTA
SMEIVETTEESADTSKGPGHSENTTKPEKTHV

www.000webhost.com

Other information
Ka divergence:0.0738884KaKs divergence:0.374536
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1485Length 2 (bp):1539Length divergence:0.018
MFE 1 (kcal):-433.4MFE 2 (kcal):-475.17MFE divergence0.046